|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G18790 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L33 family protein | chr5:6266324-6266500 REVERSE LENGTH=58 | SoyBase | E_val: 2.00E-13 | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0015934 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| KOG3505 | KOG | Mitochondrial/chloroplast ribosomal protein L33-like | JGI | ISS | |
| PTHR15238 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PF00471 | PFAM | Ribosomal protein L33 | JGI | ISS | |
| UniRef100_E6ZMV6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Probable 50s ribosomal protein L33 n=1 Tax=Sporisorium reilianum SRZ2 RepID=E6ZMV6_SPORE | SoyBase | E_val: 5.00E-11 | ISS |
| UniRef100_I1M354 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M354_SOYBN | SoyBase | E_val: 3.00E-24 | ISS |
|
Glyma13g34935 not represented in the dataset |
Glyma13g34935 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.13g274200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma13g34935.1 sequence type=CDS gene model=Glyma13g34935 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTGGGGATGATTGATTATGTATATAGGTTGCTTGTCAACGACACGTGCTCCTGTTGTTTGTGTATGGCCCAAAGAAAGGCTTCAAGAAGCAGCAGTAAGGAAAAGAATAAGATCATCAGGGTTGTCTCAACGGCTGGGACTGGATTCTTTTATGCCATGAGGAAAAGCAGGAAGATGGACAAGCTTGAGCTGAAGAAATATGATCCAAAGGTAAAGCGCCATGTTGTGTTCAGAGAATCCAAATAA
>Glyma13g34935.1 sequence type=predicted peptide gene model=Glyma13g34935 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVGMIDYVYRLLVNDTCSCCLCMAQRKASRSSSKEKNKIIRVVSTAGTGFFYAMRKSRKMDKLELKKYDPKVKRHVVFRESK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||