SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma13g34240

Feature Type:gene_model
Chromosome:Gm13
Start:35869050
stop:35871063
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G56400AT Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 70 | chr3:20909082-20910409 REVERSE LENGTH=294 SoyBaseE_val: 9.00E-31ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009625GO-bp Annotation by Michelle Graham. GO Biological Process: response to insect SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009759GO-bp Annotation by Michelle Graham. GO Biological Process: indole glucosinolate biosynthetic process SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009864GO-bp Annotation by Michelle Graham. GO Biological Process: induced systemic resistance, jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010120GO-bp Annotation by Michelle Graham. GO Biological Process: camalexin biosynthetic process SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0045088GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of innate immune response SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:1900056GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of leaf senescence SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_G7IR30UniRef Annotation by Michelle Graham. Most informative UniRef hit: WRKY transcription factor n=1 Tax=Medicago truncatula RepID=G7IR30_MEDTR SoyBaseE_val: 6.00E-80ISS
UniRef100_I1M2Y3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M2Y3_SOYBN SoyBaseE_val: 2.00E-164ISS

LocusGene SymbolProtein Name
WRKY135 WRKY Transcription Factor

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g267400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g34240.2   sequence type=CDS   gene model=Glyma13g34240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAATCAGCCATCAAATGGAAGAAAGGCAATAGAAGAAGAACTAATCAAAGGGCGTGACATAGCAAACCAGTTACTTGAAATACTTGCTCCTAAATCCAATACTACTCAACATAAGGGTGTAGAAGTGGAAGCGTTAGTGTTACCATTTGCTGAAGATCTTGTTCGCAAGGTTCTCAGATCACTCACAAATACCCTTTTGCTATTGAACACTCATAGTGATCATGTCTCCGATGAGGTTGTTTTGCCTGTCACTATCAAAGGTGTCTCTTCGTCCGTGAAATGCCAAAAGCCTGAGTATAAGGATGAGTCTTTCAACGCTAAAAGACGAAGTGGGAGCTACAAGAGAAAATCAAGTGCACCAACATGGGAGAAGAACAGTTCAATTCTGATGGAAGATGGCTATGCATGGAGAAAGTATGGACAAAAAATGACAATGAATGCAAAATACCTCAGGAACTACTACAGATGCACTCACAAGTATGATCAGGGTTGTCTAGCAACCAAACAGGTCCAAAGAATTCAAGAAGATCCTCCGTTGTACCATACAACTTATTATGGCCATCACAATTGCAAAAGCTCTTTAATGTTGGAACCAGCTTCTTCTTCTGACTCTTCTATGTTTCTTAGTTTCAGTAACACCTTCCCAAACAAAGCAGAATACCCATTTTCATCATCACTTTATTCATCCATGAAACAGGAGCCTATGGAAGTGATTCATGAAGACCATATTGTTCACAACCAATTACCCTCATCAGATTACCACATGTTATGTGACTATGATCTTGATTTTAATTATTCGAGGTATGGTACTATGCTATCCTCCACTGAATCTGTACAATTTGATGAAGTTTGTCGGAGTGATCAGGAATTTGATGGCTAG

>Glyma13g34240.2   sequence type=predicted peptide   gene model=Glyma13g34240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MENQPSNGRKAIEEELIKGRDIANQLLEILAPKSNTTQHKGVEVEALVLPFAEDLVRKVLRSLTNTLLLLNTHSDHVSDEVVLPVTIKGVSSSVKCQKPEYKDESFNAKRRSGSYKRKSSAPTWEKNSSILMEDGYAWRKYGQKMTMNAKYLRNYYRCTHKYDQGCLATKQVQRIQEDPPLYHTTYYGHHNCKSSLMLEPASSSDSSMFLSFSNTFPNKAEYPFSSSLYSSMKQEPMEVIHEDHIVHNQLPSSDYHMLCDYDLDFNYSRYGTMLSSTESVQFDEVCRSDQEFDG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo