SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g33987): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g33987): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g33987

Feature Type:gene_model
Chromosome:Gm13
Start:35663362
stop:35667712
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G78600AT Annotation by Michelle Graham. TAIR10: light-regulated zinc finger protein 1 | chr1:29567370-29568662 FORWARD LENGTH=299 SoyBaseE_val: 2.00E-92ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009641GO-bp Annotation by Michelle Graham. GO Biological Process: shade avoidance SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009718GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010099GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of photomorphogenesis SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016607GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear speck SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PF00643PFAM B-box zinc finger JGI ISS
UniRef100_B9SEX4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein, putative n=1 Tax=Ricinus communis RepID=B9SEX4_RICCO SoyBaseE_val: 1.00E-118ISS
UniRef100_UPI000189D23DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189D23D related cluster n=1 Tax=unknown RepID=UPI000189D23D SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g33987 not represented in the dataset

Glyma13g33987 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g36260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g265000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g33987.1   sequence type=CDS   gene model=Glyma13g33987   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATTCAGTGTAACGTGTGTGAGGCTGCGGAGGCCAAGGTTCTGTGTTGTGCTGACGAGGCTGCGCTGTGTTGGGAGTGTGATGAGAAGGTTCATGCGGCTAACAAGCTTGCCAGCAAGCACCAGAGAGTGCCTCTTTCTACCTCTTCCTCTCATATGCCCAAATGTGACATTTGTCAGGAAGCATTAGGCTATTTTTTCTGTCTAGAAGATCGGGCTCTGCTCTGCAGAAAATGTGATGTGGCAATACACACTGCAAATGCTTATGTCTCTGGTCATCAGAGGTTTCTTCTCACTGGTGTAAGAGTAGGCCTTGAAGCTATAGACCCTGGTGCTTCCTTAACTTCTTTGAAGTCAGATTCTGGGGAGAAAGTTTCAGATACAAAGTCTTCTTCTGTCTCTAGAAAGGTTTCCACAGTGCCCCAGCCATCAAATTACAATGAAGTGCTACCCATTGAAGTTGGAGGAGTTGGGGAGTTTCCACCAGCCAAGGTGTCTTTTGGTGGTGGTTCTACAGATGGAAATATCTCACAGTGGACTATTGATGAATTTATTGGCTTAAACGAGTTCAGTCAGCATTATGATTACATGGAAGGATCATCAAGGGCCGATGGTGGTAAGCTTGGGGATTCTGATTCTCCTGTTTTAAAGTCTGGTGAAGAGGATATGGAGGAGGAGGATGACTATTTGGAACGTGTTCCAGATTCGTCGTGGACAGTTCCTCAGATCCCTTCCCCACCTACTGCTTCTGGGTTATGCTGGCCAAAAGACCCTCAATATTCATCTGATAGTGTTCTGTTTGTTCCTGACATAAGCTTCTCTCTCATTCAACAATCTCAGATTAGTAGTATTTGTTTGAGACGCTGGAGGCAGCTTTAA

>Glyma13g33987.1   sequence type=predicted peptide   gene model=Glyma13g33987   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKIQCNVCEAAEAKVLCCADEAALCWECDEKVHAANKLASKHQRVPLSTSSSHMPKCDICQEALGYFFCLEDRALLCRKCDVAIHTANAYVSGHQRFLLTGVRVGLEAIDPGASLTSLKSDSGEKVSDTKSSSVSRKVSTVPQPSNYNEVLPIEVGGVGEFPPAKVSFGGGSTDGNISQWTIDEFIGLNEFSQHYDYMEGSSRADGGKLGDSDSPVLKSGEEDMEEEDDYLERVPDSSWTVPQIPSPPTASGLCWPKDPQYSSDSVLFVPDISFSLIQQSQISSICLRRWRQL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo