SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g33880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g33880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g33880

Feature Type:gene_model
Chromosome:Gm13
Start:35553328
stop:35554885
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G17020AT Annotation by Michelle Graham. TAIR10: senescence-related gene 1 | chr1:5820258-5821741 FORWARD LENGTH=358 SoyBaseE_val: 5.00E-27ISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0009830GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification involved in abscission SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010260GO-bp Annotation by Michelle Graham. GO Biological Process: organ senescence SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016682GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
PTHR10209Panther FE(II)/ ASCORBATE OXIDASE SUPERFAMILY JGI ISS
PTHR10209:SF55Panther OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI JGI ISS
PF03171PFAM 2OG-Fe(II) oxygenase superfamily JGI ISS
UniRef100_G8A253UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein SRG1 n=1 Tax=Medicago truncatula RepID=G8A253_MEDTR SoyBaseE_val: 2.00E-28ISS
UniRef100_UPI000233B91FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B91F related cluster n=1 Tax=unknown RepID=UPI000233B91F SoyBaseE_val: 4.00E-38ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g33880 not represented in the dataset

Glyma13g33880 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g33880.1   sequence type=CDS   gene model=Glyma13g33880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTTAGCTCATCCTTGCTGTGGAGAAAATAAAGTTGGAGAGTCAAGACTTCTTCAACCTCCCAATGTCAGAGAAGAAAAAGTTTGGCAAACTCCAGAGCATATGGAAGGATTTGGACAGGCGTTTGTTGTGAGTGAAGATCAGAAACTTGATTGGGATGCAGTAGCTCTCACTATCATTTTACAAGCCAATGAAGTAAAAGCGCTGCAGATAAGGAAGAATGGCATGTGGGTCCCTGTTAGGCCCTTGCCTAACGCCTTTGTTGTTAATATTGTTAGTAGTGGGACATATCGAAGTATTGAACACCGAGCAACGGTGAACTCTGAGAAGGAAAGGATTTCAATTGCAACATTCTATAGTCCAAGACAAGAT

>Glyma13g33880.1   sequence type=predicted peptide   gene model=Glyma13g33880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLAHPCCGENKVGESRLLQPPNVREEKVWQTPEHMEGFGQAFVVSEDQKLDWDAVALTIILQANEVKALQIRKNGMWVPVRPLPNAFVVNIVSSGTYRSIEHRATVNSEKERISIATFYSPRQD







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo