Glyma13g33660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g33660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g33660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g33660

Feature Type:	gene_model
Chromosome:	Gm13
Start:	35430196
stop:	35434438
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g33660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G53530	AT	Annotation by Michelle Graham. TAIR10: Peptidase S24/S26A/S26B/S26C family protein \| chr1:19978249-19979778 FORWARD LENGTH=168	SoyBase	E_val: 2.00E-69	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0008233	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidase activity	SoyBase	N/A	ISS
GO:0008236	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type peptidase activity	SoyBase	N/A	ISS
KOG0171	KOG	Mitochondrial inner membrane protease, subunit IMP1	JGI		ISS
PTHR12383	Panther	PROTEASE FAMILY S26 MITOCHONDRIAL INNER MEMBRANE PROTEASE-RELATED	JGI		ISS
PTHR12383:SF9	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00717	PFAM	Peptidase S24-like	JGI		ISS
PF10502	PFAM	Peptidase S26	JGI		ISS
UniRef100_D7KKI9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Signal peptidase I family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KKI9_ARALL	SoyBase	E_val: 2.00E-66	ISS
UniRef100_I1M2T2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M2T2_SOYBN	SoyBase	E_val: 9.00E-119	ISS

Expression Patterns of Glyma13g33660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g33660 not represented in the dataset	Glyma13g33660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g33660

Paralog	Evidence	Comments
Glyma15g39140	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g33660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g261900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g33660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g33660

Limit To All Plant Sequences

>Glyma13g33660.1   sequence type=CDS   gene model=Glyma13g33660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGATTTGTAGGTTACATAGCGCAATGGAGAAGCGCAGCGAAGGAGGCGTTGGATCGCACAGCCATCACTGTGAAATTCCTGTGCTGGCTTCACTTCACCGGCAACTACCTCTGTTCCCCATGTCACACCTATGGGGTTAGCATGCTCCCCACCCTCAACGTCGCCGGCGACGTTCTTCTCGCCGACCACCTCTCGCCGCGGCTCGGGAACATCGGCCACGGAGACTTGGTGCTTGTTCGGTCCCCTCTGAACCCTAAGATAAGGCTGACGAAGCGCGTCGTCGCTGTGGAAGGGGACACCGTCACCTACTTCGACCCTTTGCACTCTGAGGCTGCTCAAGTTGCAGTGGTGCCAAAGGGACATGTTTGGATTCAAGGGGATAACATTTATGCTTCCCGTGATTCACGGCATTTTGGTCCTGTTCCATATGGTCTTATAGAAGGAAAAGTGTTTTTCCGGGTATGGCCACCTGATAGCTTTGGACCACTAGGCCGTTGA

Predicted protein sequences of Glyma13g33660

Limit To All Plant Sequences

>Glyma13g33660.1   sequence type=predicted peptide   gene model=Glyma13g33660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRFVGYIAQWRSAAKEALDRTAITVKFLCWLHFTGNYLCSPCHTYGVSMLPTLNVAGDVLLADHLSPRLGNIGHGDLVLVRSPLNPKIRLTKRVVAVEGDTVTYFDPLHSEAAQVAVVPKGHVWIQGDNIYASRDSRHFGPVPYGLIEGKVFFRVWPPDSFGPLGR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain