Glyma13g32680 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g32680

Feature Type:	gene_model
Chromosome:	Gm13
Start:	34775675
stop:	34778514
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g32680

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G21860	AT	Annotation by Michelle Graham. TAIR10: methionine sulfoxide reductase B 2 \| chr4:11600238-11601507 REVERSE LENGTH=202	SoyBase	E_val: 2.00E-82	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0008113	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptide-methionine (S)-S-oxide reductase activity	SoyBase	N/A	ISS
GO:0033743	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptide-methionine (R)-S-oxide reductase activity	SoyBase	N/A	ISS
KOG0856	KOG	Predicted pilin-like transcription factor	JGI		ISS
PTHR10173	Panther	METHIONINE SULFOXIDE REDUCTASE	JGI		ISS
PTHR10173:SF0	Panther	PEPTIDE METHIONINE SULFOXIDE REDUCTASE	JGI		ISS
PF01641	PFAM	SelR domain	JGI		ISS
UniRef100_C6TIU1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TIU1_SOYBN	SoyBase	E_val: 4.00E-144	ISS
UniRef100_G7JU02	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Methionine-R-sulfoxide reductase B1 protein n=2 Tax=Medicago truncatula RepID=G7JU02_MEDTR	SoyBase	E_val: 2.00E-96	ISS

Expression Patterns of Glyma13g32680

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g32680

Paralog	Evidence	Comments
Glyma15g06650	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g32680 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g253800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g32680

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g32680

Limit To All Plant Sequences

>Glyma13g32680.1   sequence type=CDS   gene model=Glyma13g32680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGATTGAGTATTCTGAGAAGCACTTCCATTTCCACTCCTATCTCTTCCTCCAAATCCAAACCCATTTTCTCAACTCTTGTTCGTTCATCTTTCGCCTCCATTTCCCCCACAAAGTGTGTTACTCCCACCACTCTTTTCGTTTCTGCCACCCCCTTCTTCACCGCCTCACCCAAGCGCGGCTTTCGTGGTGGGATTGTGGCCATGGCCGCCGCTGGCTCGCTCCGCAAATCAGAGGAAGAGTGGCGCGCAGTTCTCTCCCCTGAACAGTTTCGTATTCTCAGGCAAAAGGGCACCGAGTTCCCTGGAACAGGAGAGTATGACAAGTTCTTTGATGAGGGAGTTTACAACTGTGCTGGTTGTGGGACACCTCTCTACAGGTCCTTAACAAAATTCAATTCTGGTTGTGGCTGGCCAGCCTTCTATGAGGGGATTCCTGGAGCCATAAATCGCAATCCGGACCCTGATGGGATGAGGACAGAAATAACGTGTGCTGCTTGTGGGGGACATCTAGGTCACGTCTTTAAAGGAGAAGGATTTCCAACGCCCACTAACGAACGCCATTGTGTCAATAGCATTTCACTGAAATTTGCGCCAGCCAATTCTTAA

Predicted protein sequences of Glyma13g32680

Limit To All Plant Sequences

>Glyma13g32680.1   sequence type=predicted peptide   gene model=Glyma13g32680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLSILRSTSISTPISSSKSKPIFSTLVRSSFASISPTKCVTPTTLFVSATPFFTASPKRGFRGGIVAMAAAGSLRKSEEEWRAVLSPEQFRILRQKGTEFPGTGEYDKFFDEGVYNCAGCGTPLYRSLTKFNSGCGWPAFYEGIPGAINRNPDPDGMRTEITCAACGGHLGHVFKGEGFPTPTNERHCVNSISLKFAPANS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain