SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g32500

Feature Type:gene_model
Chromosome:Gm13
Start:34649990
stop:34650777
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g32500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G19690AT Annotation by Michelle Graham. TAIR10: CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein | chr3:6842365-6842850 REVERSE LENGTH=161 SoyBaseE_val: 5.00E-64ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR10334Panther CYSTEINE-RICH SECRETORY PROTEIN (CRISP/SCP/TPX1)-RELATED JGI ISS
PF00188PFAM Cysteine-rich secretory protein family JGI ISS
UniRef100_C6T1N0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6T1N0_SOYBN SoyBaseE_val: 6.00E-126ISS
UniRef100_Q9XFB4UniRef Annotation by Michelle Graham. Most informative UniRef hit: PR1a n=1 Tax=Glycine max RepID=Q9XFB4_SOYBN SoyBaseE_val: 2.00E-123ISS

Expression Patterns of Glyma13g32500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g32500
ParalogEvidenceComments
Glyma15g06830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g32500 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g251600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g32500
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g32500
>Glyma13g32500.1   sequence type=CDS   gene model=Glyma13g32500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTACATGTGCATTAAGATTTCGTTTTGTGTGATGTGTGTGTTGGGGTTGGTGATCGTGGGTGATGTTGCCTACGCTCAAGATTCAGCAGAAGACTACGTGAATGCACACAATGCAGCACGAGCAGAGGTGGGTTCTCAATCACCAAGACAAACAGTGATTGTTCCAAGTTTGGCTTGGGATGATACGGTTGCTGCTTATGCAGAGAGCTATGCTAATCAACGCAAAGGTGACTGCCAACTGATCCACTCTGGTGGTGAATACGGAGAGAATATTGCAATGAGCACTGGTGAACTAAGTGGCACAGATGCAGTGAAAATGTGGGTTGATGAGAAATCCAACTATGACTATGATTCTAACTCTTGTGTTGGAGGAGAGTGCCTGCACTACACACAGGTCGTTTGGGCTAACTCGGTGCGTCTTGGATGTGCCAAAGTGACATGTGATAACGGAGGCACTTTCATCACTTGCAACTATGATCCCCCTGGCAACTTTGTTGGTGAAAGACCCTACAAACTGTAG
Predicted protein sequences of Glyma13g32500
>Glyma13g32500.1   sequence type=predicted peptide   gene model=Glyma13g32500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGYMCIKISFCVMCVLGLVIVGDVAYAQDSAEDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAAYAESYANQRKGDCQLIHSGGEYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGECLHYTQVVWANSVRLGCAKVTCDNGGTFITCNYDPPGNFVGERPYKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo