|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG00900 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein S7p/S5e family protein | chrC:97478-97945 REVERSE LENGTH=155 | SoyBase | E_val: 3.00E-23 | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0000312 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid small ribosomal subunit | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0015935 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| PF00177 | PFAM | Ribosomal protein S7p/S5e | JGI | ISS | |
| UniRef100_G3ETV9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Ribosomal protein S7 n=1 Tax=Cucumis melo subsp. melo RepID=G3ETV9_CUCME | SoyBase | E_val: 7.00E-21 | ISS |
| UniRef100_G3ETV9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein S7 n=1 Tax=Cucumis melo subsp. melo RepID=G3ETV9_CUCME | SoyBase | E_val: 7.00E-21 | ISS |
|
Glyma13g31895 not represented in the dataset |
Glyma13g31895 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.13g245200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma13g31895.1 sequence type=CDS gene model=Glyma13g31895 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATTTTATCCCTTATAAAAGTTATAAAAAAATGGATTCCTCCTTTCACGCTCATGTCACGGCGAGGTACTGGAGAAGAAAAAATCGCAAAATCTGATCAAATTTATCGTAATCGATTAGTTAACATGTTGGTTAACCGTATTCTGAAACACGGAAAAAAATCGTTGGCTTATCAAATTATCTATCGGCCCTTGATAAGCGACTCGGCTCATTTCCATTCCCGCCTGTAA
>Glyma13g31895.1 sequence type=predicted peptide gene model=Glyma13g31895 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MILSLIKVIKKWIPPFTLMSRRGTGEEKIAKSDQIYRNRLVNMLVNRILKHGKKSLAYQIIYRPLISDSAHFHSRL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||