Glyma13g31895 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g31895): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g31895): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g31895

Feature Type:	gene_model
Chromosome:	Gm13
Start:	34232404
stop:	34232673
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g31895

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00900	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein S7p/S5e family protein \| chrC:97478-97945 REVERSE LENGTH=155	SoyBase	E_val: 3.00E-23	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0000312	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid small ribosomal subunit	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0015935	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PF00177	PFAM	Ribosomal protein S7p/S5e	JGI		ISS
UniRef100_G3ETV9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Ribosomal protein S7 n=1 Tax=Cucumis melo subsp. melo RepID=G3ETV9_CUCME	SoyBase	E_val: 7.00E-21	ISS
UniRef100_G3ETV9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein S7 n=1 Tax=Cucumis melo subsp. melo RepID=G3ETV9_CUCME	SoyBase	E_val: 7.00E-21	ISS

Expression Patterns of Glyma13g31895

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g31895 not represented in the dataset	Glyma13g31895 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g31895 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g245200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g31895

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g31895

Limit To All Plant Sequences

>Glyma13g31895.1   sequence type=CDS   gene model=Glyma13g31895   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTTTATCCCTTATAAAAGTTATAAAAAAATGGATTCCTCCTTTCACGCTCATGTCACGGCGAGGTACTGGAGAAGAAAAAATCGCAAAATCTGATCAAATTTATCGTAATCGATTAGTTAACATGTTGGTTAACCGTATTCTGAAACACGGAAAAAAATCGTTGGCTTATCAAATTATCTATCGGCCCTTGATAAGCGACTCGGCTCATTTCCATTCCCGCCTGTAA

Predicted protein sequences of Glyma13g31895

Limit To All Plant Sequences

>Glyma13g31895.1   sequence type=predicted peptide   gene model=Glyma13g31895   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MILSLIKVIKKWIPPFTLMSRRGTGEEKIAKSDQIYRNRLVNMLVNRILKHGKKSLAYQIIYRPLISDSAHFHSRL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain