Glyma13g31650 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g31650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g31650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g31650

Feature Type:	gene_model
Chromosome:	Gm13
Start:	34044845
stop:	34045684
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g31650

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G49910	AT	Annotation by Michelle Graham. TAIR10: Translation protein SH3-like family protein \| chr3:18504311-18504751 FORWARD LENGTH=146	SoyBase	E_val: 1.00E-86	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0015934	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3401	KOG	60S ribosomal protein L26	JGI		ISS
PTHR11143	Panther	60S RIBOSOMAL PROTEIN L26 FAMILY MEMBER	JGI		ISS
PF00467	PFAM	KOW motif	JGI		ISS
UniRef100_B9SH02	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L26, putative n=1 Tax=Ricinus communis RepID=B9SH02_RICCO	SoyBase	E_val: 2.00E-87	ISS
UniRef100_I1M290	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M290_SOYBN	SoyBase	E_val: 9.00E-100	ISS

Expression Patterns of Glyma13g31650

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g31650 not represented in the dataset	Glyma13g31650 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g31650 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g243100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g31650

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g31650

Limit To All Plant Sequences

>Glyma13g31650.1   sequence type=CDS   gene model=Glyma13g31650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGTTCAATCCACGTGTGTCGAGCAGCCGCCGCAAGAGCCGAAAGGCTCATTTCACGGCGCCGTCGAGCGTGCGGCGGGTGCTTATGAGCGCCCCTCTGTCGGCGGAGCTGCGGTCCAAGTACAACGTGAGGTCGATCCCAGTACGGAAGGAGGACGAGGTGCAGGTGGTGCGAGGAACATACAAGGGTCGCGAGGGGAAGGTGACTCAGGTCTACCGTCGAAAGTGGGTGATTCACATTGAGCGCATAACCCGCGAGAAGGTGAATGGTTCCACCGTCAACGTTGGGATTCACCCCTCCAAGGTTGTGCTGACCAAGCTCAAATTGGACAAGGACCGTAAGGCCATTCTCGATCGCAAGGCCAAGGGTCGCGCCGCCTCCGATAAGGAGAAGGGTACCAAGTTCGCTCCCGAAGATATCATGCAAACCGTTGATTAG

Predicted protein sequences of Glyma13g31650

Limit To All Plant Sequences

>Glyma13g31650.1   sequence type=predicted peptide   gene model=Glyma13g31650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKFNPRVSSSRRKSRKAHFTAPSSVRRVLMSAPLSAELRSKYNVRSIPVRKEDEVQVVRGTYKGREGKVTQVYRRKWVIHIERITREKVNGSTVNVGIHPSKVVLTKLKLDKDRKAILDRKAKGRAASDKEKGTKFAPEDIMQTVD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain