Glyma13g31630 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g31630

Feature Type:	gene_model
Chromosome:	Gm13
Start:	34019427
stop:	34019886
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g31630

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G61105	AT	Annotation by Michelle Graham. TAIR10: Toll-Interleukin-Resistance (TIR) domain family protein \| chr1:22513616-22514492 REVERSE LENGTH=188	SoyBase	E_val: 2.00E-35	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
PF01582	PFAM	TIR domain	JGI		ISS
UniRef100_G7INZ8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: TMV resistance protein N n=2 Tax=Medicago truncatula RepID=G7INZ8_MEDTR	SoyBase	E_val: 8.00E-39	ISS
UniRef100_I1M288	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M288_SOYBN	SoyBase	E_val: 1.00E-57	ISS

Expression Patterns of Glyma13g31630

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g31630 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g242900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g31630

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g31630

Limit To All Plant Sequences

>Glyma13g31630.2   sequence type=CDS   gene model=Glyma13g31630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAACCTGGCCATAAGCTATTTGAGCATATCAACAAAGCCATTCATAGCTCCAAGGTTGGTGTTGCTGTCCCCACAAATCGTTATTGTAATTCCTACTTCTGTCTTCACGAACTTGCCCTTCTTCATGAGTCCAAGAAAAGGGTTGTCCCTATCTTTTATGACATCAAGCCCTCACAGCTTCAGGTTGAGGGCAACGCACGTTGTCCACCTCAAGTGCTCCAAACGTTCACGTCTGCTCTGGAAGAAACTAAATACACTGTAGGAGTCACCTTTGACTCTTTAAATGGGTACTGGATGGAGCTGCAAAGACGGATTTAG

Predicted protein sequences of Glyma13g31630

Limit To All Plant Sequences

>Glyma13g31630.2   sequence type=predicted peptide   gene model=Glyma13g31630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKPGHKLFEHINKAIHSSKVGVAVPTNRYCNSYFCLHELALLHESKKRVVPIFYDIKPSQLQVEGNARCPPQVLQTFTSALEETKYTVGVTFDSLNGYWMELQRRI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain