SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g30331

Feature Type:gene_model
Chromosome:Gm13
Start:33007956
stop:33010080
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g30331
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29160AT Annotation by Michelle Graham. TAIR10: Dof-type zinc finger DNA-binding family protein | chr1:10183797-10184324 REVERSE LENGTH=175 SoyBaseE_val: 3.00E-42ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PF02701PFAM Dof domain, zinc finger JGI ISS
UniRef100_B0EW02UniRef Annotation by Michelle Graham. Best UniRef hit: Dof10 transcription factor n=1 Tax=Glycine max RepID=B0EW02_SOYBN SoyBaseE_val: 3.00E-105ISS
UniRef100_B0EW02UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dof10 transcription factor n=1 Tax=Glycine max RepID=B0EW02_SOYBN SoyBaseE_val: 3.00E-105ISS

Expression Patterns of Glyma13g30331
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g30331 not represented in the dataset
Glyma13g30331 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g30331
ParalogEvidenceComments
Glyma15g08860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g30331 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g230200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g30331
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g30331
>Glyma13g30331.1   sequence type=CDS   gene model=Glyma13g30331   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGAGGAGTCTCAAGGGATTAAGCTGTTTGGTGCAATGATTACATTGAACCGTGGGGAAGTAAACAAAGGAGAAAAGGGAAGCGAATATGAGAGGGTGGAGAAGAGAGCAGAGAAGATAATACCCTGTCCGAGATGCAAGAGCATGGAAACTAAGTTCTGTTACTTCAATAACTACAACGTTAATCAGCCAAGGCATTTCTGCAAGAGCTGCCAGAGGTACTGGACGGCTGGTGGGGCCCTCCGAAACGTCGCGGTGGGCGCCGGTCGCCGGAAGGTTAAGTCACCGTGCCATGGAGCCGGTGTCTATGAAAGTACTTCTGAAGATGAAAACAAGTTTGAGATGGGTCAGGGACACGTTGCCATGCCCAACACTGGTTTCCGGCAGATTTTTCAGGCCAAGCGGCAGAGGATCACCTCAGCTCAGCATCAAGGTCAATAA
Predicted protein sequences of Glyma13g30331
>Glyma13g30331.1   sequence type=predicted peptide   gene model=Glyma13g30331   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEESQGIKLFGAMITLNRGEVNKGEKGSEYERVEKRAEKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKSCQRYWTAGGALRNVAVGAGRRKVKSPCHGAGVYESTSEDENKFEMGQGHVAMPNTGFRQIFQAKRQRITSAQHQGQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo