SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g29510

Feature Type:gene_model
Chromosome:Gm13
Start:32398569
stop:32408416
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g29510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G18960AT Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein | chr4:10383917-10388272 FORWARD LENGTH=252 SoyBaseE_val: 9.00E-125ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0009886GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0048441GO-bp Annotation by Michelle Graham. GO Biological Process: petal development SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048497GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of floral organ identity SoyBaseN/AISS
GO:0048507GO-bp Annotation by Michelle Graham. GO Biological Process: meristem development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_Q2TUV5UniRef Annotation by Michelle Graham. Most informative UniRef hit: MADS-box protein n=1 Tax=Glycine max RepID=Q2TUV5_SOYBN SoyBaseE_val: 2.00E-178ISS
UniRef100_Q2TUV5UniRef Annotation by Michelle Graham. Best UniRef hit: MADS-box protein n=1 Tax=Glycine max RepID=Q2TUV5_SOYBN SoyBaseE_val: 2.00E-178ISS

Expression Patterns of Glyma13g29510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g29510
ParalogEvidenceComments
Glyma15g09500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g29510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g223300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g29510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g29510
>Glyma13g29510.1   sequence type=CDS   gene model=Glyma13g29510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTTCCAGACCCATCCATGTCAGTTTCTCCACAGAGGAAGATGGGAAGGGGGAAGATTGAGATCAAGAGGATTGAGAACACTACCAATCGCCAAGTCACATTCTGCAAGCGCAGGAACGGCTTGCTCAAGAAAGCATATGAATTATCTGTGCTTTGTGATGCAGAGGTTGCTCTCATTGTTTTCTCTAGCCGTGGACGCCTCTATGAATATGCTAATAACAGTGTCAAAGCAACCATCGAGAGGTACAAAAAAGCAAGTTCAGATTCGTCTGGCGCTGGATCTGCTTCTGAGGCTAATGCTCAGTTTTACCAGCAAGAAGCAGATAAACTTCGTCAACAAATTAGTAACCTGCAGAATAACAACAGGCAAATGATGGGTGATTCTTTGGGCTCTCTGACTGCCAAGGATCTCAAAAATCTGGAGACTAAATTAGAAAAAGGAATTAGTAGGATTCGTTCAAAAAAGAACGAGCTGCTATTTGCTGAAATTGAGTACATGCAAAAGAGGGAGATAGACTTGCACAACAACAACCAGCTTCTTCGAGCAAAGATAGCTGAAAGTGAGAGGAACCACCATAACATGGCTGTGTTGCCTGGAGGCTCAAACTATGACTCTATGCAGTCTTCTCAGCAACAATTTGACTCTCGTGGCTACTTCCAAGTCACTGGATTACAACCCAATAATCAGTATGCACGGCAAGATCAGATGTCCCTTCAATTAGTATGA
Predicted protein sequences of Glyma13g29510
>Glyma13g29510.1   sequence type=predicted peptide   gene model=Glyma13g29510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFPDPSMSVSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATIERYKKASSDSSGAGSASEANAQFYQQEADKLRQQISNLQNNNRQMMGDSLGSLTAKDLKNLETKLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAESERNHHNMAVLPGGSNYDSMQSSQQQFDSRGYFQVTGLQPNNQYARQDQMSLQLV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo