Report for Sequence Feature Glyma13g29480
Feature Type: gene_model
Chromosome: Gm13
Start: 32366246
stop: 32368669
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g29480
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G45660 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr5:18525103-18526726 FORWARD LENGTH=226
SoyBase E_val: 2.00E-49 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1M1L9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M1L9_SOYBN
SoyBase E_val: 2.00E-147 ISS
Expression Patterns of Glyma13g29480
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma13g29480 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g222900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g29480
Coding sequences of Glyma13g29480
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g29480.1 sequence type=CDS gene model=Glyma13g29480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAACCGTTCGATCAAACTCGATTACCGTCTTCTTCGTGGCATTCATTATCCTCACAACAGCACCATCTCCTTCCCAATCCCTCTCTTTCTCCTCTTTCTTCCGTTACCGAAACCTCTTCTCCCTCTCGCACTCCCTCCTCATCGGCGTCGCCAACCTCCGCGCCGCACGCGGCGACGTCGCCGGCGCCGATCGAGCCAGGTCCATCGCCGACGGCCTCGATCAGGGAACCGTCTTCGGCTTCTTGAAGCTCCTCTGGACATTGTCGTGGACGGATATGTCCTTCACGGACCTCTACGGCGCTGTTTCCGACATGAACGAGCTGCTGCGGGGCTTGACTGAGTTGACTCGCTTGGAATCGGTCGCGGAAAGGTCCGCTTGGGTTTCCCGAAATTACCAAAGTGTCCTCACCGTCTTTAAGTCCCTCTCCAGAAAGCTCCTCAAAGCGCTTGGCCAGTCGGGAGTGATGAGGGAAATAGGGGAGACGTTTCAGAAAGAGGTGGTGGAAGGTGGATTAATCAGGGATTGCCTTGAATTGGGTAACAATGATCTAAAGGCTTTGATTCAGATTGTCAAGGATTTGTTGTTGCAATTCTTTCCTGTTCGTGATAAAGACCATGATCTATAG
Predicted protein sequences of Glyma13g29480
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g29480.1 sequence type=predicted peptide gene model=Glyma13g29480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MATVRSNSITVFFVAFIILTTAPSPSQSLSFSSFFRYRNLFSLSHSLLIGVANLRAARGDVAGADRARSIADGLDQGTVFGFLKLLWTLSWTDMSFTDLYGAVSDMNELLRGLTELTRLESVAERSAWVSRNYQSVLTVFKSLSRKLLKALGQSGVMREIGETFQKEVVEGGLIRDCLELGNNDLKALIQIVKDLLLQFFPVRDKDHDL*