Glyma13g29190 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g29190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g29190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g29190

Feature Type:	gene_model
Chromosome:	Gm13
Start:	32139070
stop:	32141876
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g29190

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G34650	AT	Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein \| chr2:14589934-14591557 REVERSE LENGTH=438	SoyBase	E_val: 0	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0008361	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell size	SoyBase	N/A	ISS
GO:0009637	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to blue light	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009734	GO-bp	Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway	SoyBase	N/A	ISS
GO:0009926	GO-bp	Annotation by Michelle Graham. GO Biological Process: auxin polar transport	SoyBase	N/A	ISS
GO:0009958	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive gravitropism	SoyBase	N/A	ISS
GO:0043481	GO-bp	Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light	SoyBase	N/A	ISS
GO:0048364	GO-bp	Annotation by Michelle Graham. GO Biological Process: root development	SoyBase	N/A	ISS
GO:0048443	GO-bp	Annotation by Michelle Graham. GO Biological Process: stamen development	SoyBase	N/A	ISS
GO:0048766	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair initiation	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0048825	GO-bp	Annotation by Michelle Graham. GO Biological Process: cotyledon development	SoyBase	N/A	ISS
GO:0048827	GO-bp	Annotation by Michelle Graham. GO Biological Process: phyllome development	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009986	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell surface	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0042802	GO-mf	Annotation by Michelle Graham. GO Molecular Function: identical protein binding	SoyBase	N/A	ISS
KOG0610	KOG	Putative serine/threonine protein kinase	JGI		ISS
PTHR24351	Panther	RIBOSOMAL PROTEIN S6 KINASE	JGI		ISS
PTHR24351:SF88	Panther		JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
UniRef100_I1M1I1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M1I1_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q6RC06	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine protein kinase n=1 Tax=Pisum sativum RepID=Q6RC06_PEA	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma13g29190

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g29190 not represented in the dataset	Glyma13g29190 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g29190 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g220100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g29190

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g29190

Limit To All Plant Sequences

>Glyma13g29190.1   sequence type=CDS   gene model=Glyma13g29190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGACTGGTGGTGGACGCGATTCTGGCATGAGTTCTGAGACTATCAATTCCTCCACTCAAAGAACTTCAATGAGCAACGAGAGCGTTTGCAGCACCAGCTTCAGCCGTCTCTCCTTCGATCTCCCTCCTCCTTCTTCTTCCCCTGAGACCCTCTTCGTCAAACCCCACCGCTCCTCCGACTTCGCCTACTCCGCCATCCTCCGCCGCAAGTCCGCCCTCACCTTCCGCGACTTCCACCTCCTCCGCCGCATCGGCGCCGGCGACATCGGCACCGTCTACCTCTGCCGTCTCCGCCACGACGCCGGCGACGAGGACGACGACGAGGACCCCTGTTTCTACGCGATGAAGGTGGTGGACAAGGAGGCGGTGGCGCTGAAGAAGAAGGCGCAGAGAGCGGAGATGGAGAGGAAGATTCTGAAGATGGTGGACCATCCGTTCCTCCCTACGCTCTACGCGGAGTTCGAGGCTTCGAATTTCTCATGCATTGTGATGGAGTATTGCTCCGGTGGGGACTTGCACTCCCTTCAACACAACCACCCCAATAACCGATTCTCTCTCTCCTCTGCCAGGTTTTACGCGGCTGAAGTACTGGTTGCGTTGGAGTATCTCCACATGCTGGGAATCATCTACAGGGATCTGAAGCCCGAAAACGTGTTGGTCAGATCAGACGGTCACATCATGCTTTCCGACTTCGATCTCTCTCTATGCTCCGATGCTATCCCAGCCGTTGAATCCCCTGACTGTTCACTGGACCCCGCATTCGCACCCGCGTTACGCTACACTCGCCAGTACTCCACCCCCTTCTCCTGCCTCTCGAACCGCGTATTCCGGTCCAGGAAGGTCCAGACCCTCCAACCCAACCGCCTCTTCGTGGCCGAACCGGTCGGGGCCCGCTCGTGCTCCTTCGTTGGGACCCACGAGTACGTGTCGCCGGAAGTGGCCTCCGGGAACTCACACGGCAATGCCGTCGACTGGTGGTCCTTCGGGATATTCATCTACGAGATGGTGTACGGTCGAACACCCTTCGCGGGATCATCGAACGAGGCTACGCTGCGAAGCATCATCAAAAAGCCCCTCGCATTTCCCACCTCCACGCCCTCCAGTACGCTTGAAATGCACGCGCGGGACCTCATATCAGGGTTGCTCAACAAGGACCCGAACCGCAGGCTCGGGTCCAAACGAGGCTCTGCGGACGTCAAAAAACACCCCTTCTTCGCGGGGCTCAATCTCGCGCTCATCCGGACGGTCACGCCGCCGGAGGTTCCATCACTCAGAAGGCATAAAACGACGCCGTTTTACTACCCCGCCAACGTAAATAACAGTAGACAGCAGCTAACGGCGTTTGATTACTTTTGA

Predicted protein sequences of Glyma13g29190

Limit To All Plant Sequences

>Glyma13g29190.1   sequence type=predicted peptide   gene model=Glyma13g29190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METGGGRDSGMSSETINSSTQRTSMSNESVCSTSFSRLSFDLPPPSSSPETLFVKPHRSSDFAYSAILRRKSALTFRDFHLLRRIGAGDIGTVYLCRLRHDAGDEDDDEDPCFYAMKVVDKEAVALKKKAQRAEMERKILKMVDHPFLPTLYAEFEASNFSCIVMEYCSGGDLHSLQHNHPNNRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLSDFDLSLCSDAIPAVESPDCSLDPAFAPALRYTRQYSTPFSCLSNRVFRSRKVQTLQPNRLFVAEPVGARSCSFVGTHEYVSPEVASGNSHGNAVDWWSFGIFIYEMVYGRTPFAGSSNEATLRSIIKKPLAFPTSTPSSTLEMHARDLISGLLNKDPNRRLGSKRGSADVKKHPFFAGLNLALIRTVTPPEVPSLRRHKTTPFYYPANVNNSRQQLTAFDYF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain