SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g29120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g29120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g29120

Feature Type:gene_model
Chromosome:Gm13
Start:32051208
stop:32055675
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G08220AT Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: mitochondrial proton-transporting ATP synthase complex assembly; LOCATED IN: mitochondrial inner membrane; EXPRESSED IN: 18 plant structures; EXPRESSED DURING: 7 growth stages; CONTAINS InterPro DOMAIN/s: ATPase assembly factor ATP10, mitochondria (InterPro:IPR007849); Has 168 Blast hits to 168 proteins in 86 species: Archae - 6; Bacteria - 0; Metazoa - 2; Fungi - 107; Plants - 30; Viruses - 0; Other Eukaryotes - 23 (source: NCBI BLink). | c SoyBaseE_val: 2.00E-106ISS
GO:0033615GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial proton-transporting ATP synthase complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4614 KOG Inner membrane protein required for assembly of the F0 sector of ATP synthase JGI ISS
PF05176PFAM ATP10 protein JGI ISS
UniRef100_I1M1H0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=3 Tax=Glycine max RepID=I1M1H0_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9SGD8UniRef Annotation by Michelle Graham. Most informative UniRef hit: T23G18.8 n=1 Tax=Arabidopsis thaliana RepID=Q9SGD8_ARATH SoyBaseE_val: 3.00E-93ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g29120 not represented in the dataset

Glyma13g29120 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g219600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g29120.1   sequence type=CDS   gene model=Glyma13g29120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAGGTTTGAGGCGACTGATACGACAGCGTTCAAGTCTCAGAGACTCCTTAGCCGAGAAGGTCCATAGTCCAGTTCCCTCGCAGCATTTGGCACGCCTCACCCCCAAACGCTTCTTCGATCTTCATCAGCTTGGAAATAAGGAAGCAATTGAGAAGGAGCGCGCTCGACTTGCAGATGAAATGACTAGGGGATACTTCGCTGATATGGCTGAGTTCAAAAAGCATGCTGGTAAGATTGCTGTAGCTAATAAATTGATAATACCAGCAATGGTAGCCACAAAGTTTCCTGATTTTGAAGTCAGCTTCACAGATGGTAAAACAATGAAGCTTCCTATCCGTGTTTCTGATCGTGCAGTTGATTCTGATAAATCGTCTGTCCCCAAGGCATCTTTGGTTTGTCTTTCATTTCGAGCAAGCTCCCAGGAAATGATCAATTCTTGGAGTGTGCCTTTTACTGAAGCATTTAGAAAATCAAATGATGTTCATTTATATCAGGTATCATTTATAGATTCGTGGCTTTTATGTCGGGCTCCTATAAAACGTTTGCTTCTCTGGACAATGAAGAAACCTAGTCATCATGAAAGCAAGGATACACTTCAGCAGCAGATAGTGTATTCATTTGGTGACCACTATTATTTCAGAAAAGAACTCAGGATATTGAATCTCCTTACAGGGTATATCTTTCTACTTGATAATTTTGGTAGAGTAAGATGGCAAGGCTTTGGATCGGCGACACAAGATGAACTATCTTCTCTTCTTTCTTGTACATCACTTCTTCTTGATCAGAAATGA

>Glyma13g29120.1   sequence type=predicted peptide   gene model=Glyma13g29120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGLRRLIRQRSSLRDSLAEKVHSPVPSQHLARLTPKRFFDLHQLGNKEAIEKERARLADEMTRGYFADMAEFKKHAGKIAVANKLIIPAMVATKFPDFEVSFTDGKTMKLPIRVSDRAVDSDKSSVPKASLVCLSFRASSQEMINSWSVPFTEAFRKSNDVHLYQVSFIDSWLLCRAPIKRLLLWTMKKPSHHESKDTLQQQIVYSFGDHYYFRKELRILNLLTGYIFLLDNFGRVRWQGFGSATQDELSSLLSCTSLLLDQK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo