SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma13g29070

Feature Type:gene_model
Chromosome:Gm13
Start:32022433
stop:32025655
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G30135AT Annotation by Michelle Graham. TAIR10: jasmonate-zim-domain protein 8 | chr1:10596516-10597095 FORWARD LENGTH=131 SoyBaseE_val: 9.00E-24ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF06200PFAM tify domain JGI ISS
PF09425PFAM Divergent CCT motif JGI ISS
UniRef100_C6T1G4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1G4_SOYBN SoyBaseE_val: 3.00E-97ISS
UniRef100_G7LE60UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein TIFY 5A n=1 Tax=Medicago truncatula RepID=G7LE60_MEDTR SoyBaseE_val: 7.00E-36ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g09980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g219100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g29070.1   sequence type=CDS   gene model=Glyma13g29070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAGGAACTGCAACTTGGAACTTGCCCTTTTTCTTCCCTCTGATTCTGGCCCCCGCCACCACCACTCAATGGTTGAAGAAGCTAGTGAAATAAGCCCAATCCAAAATTTCTTCCATCACCACCACCGCCAGGAACAGCAACAGCAACAGCCGCTCACCATTTTCTATGATGGAAATATTTGTGTTGCGGATGTCACAGAGCTTCAGGCCAAATCGATTTTATTGCTTGCAAATAGAAAATTGGAGGAAAGAGTGAGGACACCAACTGGGTCAGAGCCATCTTCACCAGCAGTGATGCAATCTAACAATCAATTGTATAGTCCTGGCACTGGCCTTTCCATGAGAAAATCGTTGCAAAGGTTCCTTCAGAAGAGAAAGAATCGGGTCCAAGAAGCATCGCCATACCATCACTAG

>Glyma13g29070.1   sequence type=predicted peptide   gene model=Glyma13g29070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRRNCNLELALFLPSDSGPRHHHSMVEEASEISPIQNFFHHHHRQEQQQQQPLTIFYDGNICVADVTELQAKSILLLANRKLEERVRTPTGSEPSSPAVMQSNNQLYSPGTGLSMRKSLQRFLQKRKNRVQEASPYHH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo