SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g28750

Feature Type:gene_model
Chromosome:Gm13
Start:31740971
stop:31741279
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g28750
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15680AT Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr4:8931813-8932121 FORWARD LENGTH=102 SoyBaseE_val: 5.00E-55ISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008794GO-mf Annotation by Michelle Graham. GO Molecular Function: arsenate reductase (glutaredoxin) activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
KOG1752 KOG Glutaredoxin and related proteins JGI ISS
PTHR10168Panther GLUTAREDOXIN JGI ISS
PF00462PFAM Glutaredoxin JGI ISS
UniRef100_G7IQ03UniRef Annotation by Michelle Graham. Most informative UniRef hit: Monothiol glutaredoxin-S2 n=1 Tax=Medicago truncatula RepID=G7IQ03_MEDTR SoyBaseE_val: 6.00E-58ISS
UniRef100_I1M1D3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M1D3_SOYBN SoyBaseE_val: 3.00E-68ISS

Expression Patterns of Glyma13g28750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g28750
ParalogEvidenceComments
Glyma15g10340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g28750 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g216300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g28750
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g28750
>Glyma13g28750.1   sequence type=CDS   gene model=Glyma13g28750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATAGGGTGACACAGATGGCATCAGAGAGACCAGTGGTGATATTCAGCCGGAGTTCCTGCTGCATGTGCCACACCATCAAAACCCTCTTCAGTGACTTTGGAGTGCATCCAAATGTTCATGAACTTGATGAGATACCAAGAGGGAATGACATTGAGCAAGCTCTTTCAAGGCTAGGGTGCAGCCCCTCTGTGCCTGTTGTGTTCATTGGCGGTGAGCTTGTTGGTGGAGCCAATGAAGTCATGAGCCTTCACCTTAACCGCTCCTTGATCCCTATGCTTAGGAGAGCTGGAGCTCTTTGGGTTTGA
Predicted protein sequences of Glyma13g28750
>Glyma13g28750.1   sequence type=predicted peptide   gene model=Glyma13g28750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELDEIPRGNDIEQALSRLGCSPSVPVVFIGGELVGGANEVMSLHLNRSLIPMLRRAGALWV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo