SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g28680

Feature Type:gene_model
Chromosome:Gm13
Start:31665989
stop:31679393
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g28680
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G06390AT Annotation by Michelle Graham. TAIR10: Uncharacterised protein family (UPF0497) | chr3:1938913-1939707 REVERSE LENGTH=199 SoyBaseE_val: 5.00E-47ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR11615Panther NITRATE, FROMATE, IRON DEHYDROGENASE JGI ISS
PTHR11615:SF55Panther OS07G0442900 PROTEIN JGI ISS
PF04535PFAM Domain of unknown function (DUF588) JGI ISS
UniRef100_C6SVQ5UniRef Annotation by Michelle Graham. Most informative UniRef hit: CASP-like protein 7 n=1 Tax=Glycine max RepID=CSPL7_SOYBN SoyBaseE_val: 2.00E-78ISS
UniRef100_I1M1C5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M1C5_SOYBN SoyBaseE_val: 7.00E-131ISS

Expression Patterns of Glyma13g28680
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g28680
ParalogEvidenceComments
Glyma15g10410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g28680 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g215500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g28680
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g28680
>Glyma13g28680.1   sequence type=CDS   gene model=Glyma13g28680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTACTACAGACCCTGAGAACAAATCACCAACTCTGCCGCTGCCTCCAGCCGAAGTGGATTACTCTAAAGTTGATGTGATCCTAAGATTTCTGTTGCTGGCAGCATCGGTGGTGGCGCTTGCAGTGATTGTCTCCAGTGATCAAACAGAGCAAGTGCTCTTCCAAGATGTGCTTCTACCGCAGCCAGCCAAGTTCAAATACTCACCAGCTTTTGTATATTTTGTGGCTGCATTCAGTGTTTCTGGCCTTTATGCTCTTGTTTCTGCTCTTGCATCTATCTCTGTCATCCAGAAGCCAGGATTCAAACTGAAGTTCCTCCTCCACTTTATCTTCTGGGATGCACTGATATTGGGGATAACAGCCTCAGCAACAGGAGCAGCAGGAAGTGTGGCATATATTGGTTTAAAGGGCAACAGCCATGTGGGTTGGATTAAAGTTTGCAACATCTACGACAAGTTCTGTAGGCATCTAGCTGGCTCCATAGCAGTGGCTTTGTTTGGCAGCATTGTGACTGTCCTTCTCATCTGGCTTTCAGCTTTCACCATTCACAGTCGAGTTCCCAAATAG
Predicted protein sequences of Glyma13g28680
>Glyma13g28680.1   sequence type=predicted peptide   gene model=Glyma13g28680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATTDPENKSPTLPLPPAEVDYSKVDVILRFLLLAASVVALAVIVSSDQTEQVLFQDVLLPQPAKFKYSPAFVYFVAAFSVSGLYALVSALASISVIQKPGFKLKFLLHFIFWDALILGITASATGAAGSVAYIGLKGNSHVGWIKVCNIYDKFCRHLAGSIAVALFGSIVTVLLIWLSAFTIHSRVPK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo