Glyma13g28590 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g28590

Feature Type:	gene_model
Chromosome:	Gm13
Start:	31580214
stop:	31583044
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g28590

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G25050	AT	Annotation by Michelle Graham. TAIR10: acyl carrier protein 4 \| chr4:12870178-12871024 FORWARD LENGTH=137	SoyBase	E_val: 6.00E-37	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0009416	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to light stimulus	SoyBase	N/A	ISS
GO:0009627	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance	SoyBase	N/A	ISS
GO:0009637	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to blue light	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0010114	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to red light	SoyBase	N/A	ISS
GO:0010155	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of proton transport	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0010218	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to far red light	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0042335	GO-bp	Annotation by Michelle Graham. GO Biological Process: cuticle development	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0000036	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0031177	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphopantetheine binding	SoyBase	N/A	ISS
KOG1748	KOG	Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit	JGI		ISS
PTHR20863	Panther	ACYL CARRIER PROTEIN/ZINC FINGER PROTEIN 593-RELATED	JGI		ISS
PTHR20863:SF12	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00550	PFAM	Phosphopantetheine attachment site	JGI		ISS
UniRef100_I1M1B6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Acyl carrier protein n=1 Tax=Glycine max RepID=I1M1B6_SOYBN	SoyBase	E_val: 7.00E-94	ISS
UniRef100_I1M1B6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Acyl carrier protein n=1 Tax=Glycine max RepID=I1M1B6_SOYBN	SoyBase	E_val: 7.00E-94	ISS

Expression Patterns of Glyma13g28590

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g28590

Paralog	Evidence	Comments
Glyma15g10520	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g28590 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g214600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g28590

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g28590

Limit To All Plant Sequences

>Glyma13g28590.1   sequence type=CDS   gene model=Glyma13g28590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCCTTCTGCAATGTTCCATGCCCCTCGTCTCTCTTTCCAATCGAGCTCTGGTACCCGGTACCAGGATCTCCAACCCAAGTTCAGTTTCCCTTTCAATTAAGGGAAGAAGTTTCCCATCCGTTACATTGCAGCCCAGAGGGCGTCGGTTTCAGCTTAGATGTGCGGCAAAACCAGAGACAGTGAAGAAGGTGTGTGACATAGTCAAGAAGCAATTGGCACTGCCAGATGAATCAGCTGTTACTGGAGAGTCTAAATTTGCTGCGCTTGGAGCTGATTCTCTTGACACGGTTGAGATTGTGATGGGACTTGAGGAGGAATTTGGTATTACCGTGGAAGAAGAAAGTGCCCAGAGTATCACCACCGTTCAAGACGCTGCTGATATGATCGATAAGCTTCTTGAAACCAAGGCTTAA

Predicted protein sequences of Glyma13g28590

Limit To All Plant Sequences

>Glyma13g28590.1   sequence type=predicted peptide   gene model=Glyma13g28590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLLQCSMPLVSLSNRALVPGTRISNPSSVSLSIKGRSFPSVTLQPRGRRFQLRCAAKPETVKKVCDIVKKQLALPDESAVTGESKFAALGADSLDTVEIVMGLEEEFGITVEEESAQSITTVQDAADMIDKLLETKA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain