Report for Sequence Feature Glyma13g28020
Feature Type: gene_model
Chromosome: Gm13
Start: 31134740
stop: 31139294
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g28020
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G06180 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein L34e superfamily protein | chr3:1871705-1873554 FORWARD LENGTH=241
SoyBase E_val: 3.00E-58 ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
PTHR10759 Panther
60S RIBOSOMAL PROTEIN L34
JGI ISS
PTHR10759:SF3 Panther
STRUCTURAL CONSTITUENT OF RIBOSOME
JGI ISS
UniRef100_B9RSR8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L34, putative n=1 Tax=Ricinus communis RepID=B9RSR8_RICCO
SoyBase E_val: 2.00E-58 ISS
UniRef100_I1M156 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M156_SOYBN
SoyBase E_val: 4.00E-154 ISS
Expression Patterns of Glyma13g28020
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma13g28020
Paralog Evidence Comments
Glyma15g11004 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g28020 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g209500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g28020
Coding sequences of Glyma13g28020
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g28020.1 sequence type=CDS gene model=Glyma13g28020 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTATAGGGGGAAGGTAAAGACGAAGATGGTGCAATGCAAGAGGAGGAGGTGGCATATGAGCATGAGCATGAGCAGAGGGATGATGGTTCAGTGCAACAACACTAATAACAACGTGTGCAACTGCAAGCACTCTCCCTCGGCCACCTTAGACCTTCTAATCCTCCTCCTGGTCCTCTTCTCCGGCGCCTTCCTCCTCTCCTCCTACCTCTGCTACATCTTCAACTCCCTCTCCCTCCTCCTCCCCTCCCTCCCCCTCTCCTACCTCCTCCCCTTCCTCCTCTTCTTCTCCCTCTCCCTCGCCGCCTTCTTCTGCGGCTCCCGATCCCGCCGCTGCCAGCGCCAGGGATGCAAGGGCCTCAAGAAGGCCATGGAGTTCGATTTGCAGATTCAGCGCTTCGGCTCCTCCTCCGCCGAAATCGATAAGCTCCCCTGGAAGGGCGGCACTGAGGCCAACCCCGATTACGACTGCCTCAGGTCCGAGCTCAGGAAGATGGCTCCCCCTAACGGCCGTGCGCTTTTGCTCTTCCGGGCGCCCTGTGGCTGCCCCGTCGCCAAACTCGAGGCCTCCGGTCCCAAAAAGGGCAAACGCCATAAGAGGACCCCACCCAGTGCGACTCTTAATGGAGGAGGAGATCATCGTTGA
Predicted protein sequences of Glyma13g28020
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g28020.1 sequence type=predicted peptide gene model=Glyma13g28020 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MYRGKVKTKMVQCKRRRWHMSMSMSRGMMVQCNNTNNNVCNCKHSPSATLDLLILLLVLFSGAFLLSSYLCYIFNSLSLLLPSLPLSYLLPFLLFFSLSLAAFFCGSRSRRCQRQGCKGLKKAMEFDLQIQRFGSSSAEIDKLPWKGGTEANPDYDCLRSELRKMAPPNGRALLLFRAPCGCPVAKLEASGPKKGKRHKRTPPSATLNGGGDHR*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
