Glyma13g27790 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g27790

Feature Type:	gene_model
Chromosome:	Gm13
Start:	30912399
stop:	30915628
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g27790

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G56170	AT	Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit C2 \| chr1:21025118-21025717 FORWARD LENGTH=199	SoyBase	E_val: 3.00E-39	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0016602	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CCAAT-binding factor complex	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PTHR10252	Panther	HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATED	JGI		ISS
PTHR10252:SF6	Panther	CCAAT-BINDING TRANSCRIPTION FACTOR	JGI		ISS
PF00808	PFAM	Histone-like transcription factor (CBF/NF-Y) and archaeal histone	JGI		ISS
UniRef100_B2LSM2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: HAP5B n=3 Tax=Picea RepID=B2LSM2_9CONI	SoyBase	E_val: 1.00E-39	ISS
UniRef100_I1M135	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M135_SOYBN	SoyBase	E_val: 5.00E-140	ISS

Expression Patterns of Glyma13g27790

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g27790 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g207700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g27790

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g27790

Limit To All Plant Sequences

>Glyma13g27790.1   sequence type=CDS   gene model=Glyma13g27790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCAAAACAAGCAAGGTGAAGCAGCAGAAGGAGGGAATATTGGTCATCCAGCACATGGCAAGAACCAAGAAGAGCAATCTAACCCTATGATAGCACCTACAAATCCTCCCAAAAAGAAAAGCTTGGAGGAACAACTCAACGACTTCTGGGCAGCACAGCGCGAGGAAGCTAAGATGACCACTAATTTCAAGACTCACAGCTTGCCCTTGTCGAGGATTAAGAAGATCATTAAGACCGACAAGGATGTAAAGATGATATCTGCTGAGACTCCCGTGGTGTTTGCCAAAGCCTGTGAAATGTTCATCAAGGAGCTCACAATAAGGGCTTGGGCTAATACTGAGGCTCGCAAAGGGAAGATACTTTCCCAGCGTGACCTTGTATCCGCCATCTCCCAGACTGCTTCTTTTGATTTTCTCGATGATATTATGCCCAAGGATGCAGGCTTACCAAGAACAAGCATTGCTTCAACAGAGAATGCTTATCTAAACATGCCACCTCAGCAGAATGTTGCAGGCCTTCCATATGATGCTCCAACCATGGCCTTTCCTAATCTAAACCATCATGCTCCCAATTAG

Predicted protein sequences of Glyma13g27790

Limit To All Plant Sequences

>Glyma13g27790.1   sequence type=predicted peptide   gene model=Glyma13g27790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDQNKQGEAAEGGNIGHPAHGKNQEEQSNPMIAPTNPPKKKSLEEQLNDFWAAQREEAKMTTNFKTHSLPLSRIKKIIKTDKDVKMISAETPVVFAKACEMFIKELTIRAWANTEARKGKILSQRDLVSAISQTASFDFLDDIMPKDAGLPRTSIASTENAYLNMPPQQNVAGLPYDAPTMAFPNLNHHAPN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain