SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma13g27701

Feature Type:gene_model
Chromosome:Gm13
Start:30853574
stop:30855544
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G06050AT Annotation by Michelle Graham. TAIR10: peroxiredoxin IIF | chr3:1826311-1827809 REVERSE LENGTH=201 SoyBaseE_val: 6.00E-88ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005759GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix SoyBaseN/AISS
GO:0004601GO-mf Annotation by Michelle Graham. GO Molecular Function: peroxidase activity SoyBaseN/AISS
GO:0016209GO-mf Annotation by Michelle Graham. GO Molecular Function: antioxidant activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0541 KOG Alkyl hydroperoxide reductase/peroxiredoxin JGI ISS
PTHR10430Panther PEROXIREDOXIN-5 JGI ISS
PF08534PFAM Redoxin JGI ISS
UniRef100_H6VUU5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxiredoxin n=1 Tax=Ammopiptanthus mongolicus RepID=H6VUU5_9FABA SoyBaseE_val: 1.00E-95ISS
UniRef100_UPI000233C483UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C483 related cluster n=1 Tax=unknown RepID=UPI000233C483 SoyBaseE_val: 2.00E-140ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g27701 not represented in the dataset

Glyma13g27701 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g11255 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g206900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g27701.1   sequence type=CDS   gene model=Glyma13g27701   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAACCCGATTTGGTGAAGCGACTCACCAAGTCATTGCCTGCAACTCTTGGGTTAAAATCTTCTTCCTCTTTGGCCAAGGTTACAACTGGAACTGAAATACTCTCTATTGCACCCAATGTTTCTCTTCAGAAAGCTCGCTCATGGGACGAAGGTGTTGCTTCTAACTTCTCTACCACTCCTCTCATTGACATCTTCAAGGACAAGAAAGTGGTCATATTTGGAATCCCGGGTGCATTCACAGGGGTTTGTTCAGAAGAACATGTTCCAACTTACATGGAGAATATTGATAAGTTTAAGGCTAAGGGGATCGATACCGTTATTTGTGTCTCTATTAATGATCCATATGTTATGAATGAGTGGGCAGAGAAGCTTCAATGCAAAGATGCTATTGAGTTTTATGGGGACTTTGATGGGAGCTTTCACAAAAGCTTGAAATTAGTTACTAATCTCTCCAATGTTTTGCTTGGAACTCGATCTGAAAGATGGTCAGCATATGTGGTAGATGGAGTGATTAAGGATCTTAATGTTGAGGAAGATCCATCTGTTGTCACAGTTTCTGCTGCACAAACTATTTTGGAACAGATTTGA

>Glyma13g27701.1   sequence type=predicted peptide   gene model=Glyma13g27701   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKPDLVKRLTKSLPATLGLKSSSSLAKVTTGTEILSIAPNVSLQKARSWDEGVASNFSTTPLIDIFKDKKVVIFGIPGAFTGVCSEEHVPTYMENIDKFKAKGIDTVICVSINDPYVMNEWAEKLQCKDAIEFYGDFDGSFHKSLKLVTNLSNVLLGTRSERWSAYVVDGVIKDLNVEEDPSVVTVSAAQTILEQI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo