SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g27530

Feature Type:gene_model
Chromosome:Gm13
Start:30732668
stop:30733597
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g27530
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G21920AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: N-terminal protein myristoylation; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G20340.1); Has 40 Blast hits to 40 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 40; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr4:11636084-11636473 REVERSE LENGTH=129 SoyBaseE_val: 8.00E-13ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1M107UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M107_SOYBN SoyBaseE_val: 4.00E-94ISS

Expression Patterns of Glyma13g27530
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g27530
ParalogEvidenceComments
Glyma15g11430 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g27530 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g205200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g27530
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g27530
>Glyma13g27530.1   sequence type=CDS   gene model=Glyma13g27530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAACTGTTGTGCCAGTGCCACGGAATCATCATCTATGGATTGGGGTGGTGATGATTGGGGTTCTTTTTCATCATCCAAGAGAAGGAGGAGTTCAAGGAAGAATAAGGTGTTTGATGAAGTTCATGGGGAGAGTTTAGGGAACGTGGAGAAGGAGAAGCTCTTGGGTGCTTTGAGAGCTTCTTCTGATGCCAATGGGAAAGTGAAGATAAAGATCTCAAAGAAGGAGCTAGAAAAGTTGTTGGGAGGGAAAGAGAATAATAGTAATAAGCAAGGTGATCATGGACACGCTTCTGCGGAACAAGTTTTGGCTCGGTTGATACACGCTAGAGATCATGCGAGTAACGAATACCATGATGTTCATCATAGGTCATGGAGGCCCGTGCTTCAGAGTATACCTGAGGTTAATTAA
Predicted protein sequences of Glyma13g27530
>Glyma13g27530.1   sequence type=predicted peptide   gene model=Glyma13g27530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGNCCASATESSSMDWGGDDWGSFSSSKRRRSSRKNKVFDEVHGESLGNVEKEKLLGALRASSDANGKVKIKISKKELEKLLGGKENNSNKQGDHGHASAEQVLARLIHARDHASNEYHDVHHRSWRPVLQSIPEVN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo