Glyma13g27410 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g27410

Feature Type:	gene_model
Chromosome:	Gm13
Start:	30602021
stop:	30603082
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g27410

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G12630	AT	Annotation by Michelle Graham. TAIR10: A20/AN1-like zinc finger family protein \| chr3:4012707-4013189 FORWARD LENGTH=160	SoyBase	E_val: 2.00E-40	ISS
GO:0006007	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucose catabolic process	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0051865	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein autoubiquitination	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR10634	Panther	PRK1-ASSOCIATED ZINC FINGER PROTEIN	JGI		ISS
PF01428	PFAM	AN1-like Zinc finger	JGI		ISS
UniRef100_I1M0Z2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M0Z2_SOYBN	SoyBase	E_val: 7.00E-96	ISS
UniRef100_Q41123	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: PVPR3 protein n=1 Tax=Phaseolus vulgaris RepID=Q41123_PHAVU	SoyBase	E_val: 4.00E-75	ISS

Expression Patterns of Glyma13g27410

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g27410

Paralog	Evidence	Comments
Glyma12g36716	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g27410 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g204100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g27410

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g27410

Limit To All Plant Sequences

>Glyma13g27410.2   sequence type=CDS   gene model=Glyma13g27410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCAGAAGGCCCAGAAAAACGACACTGAGTTTAAGGTCCCCGAACCCATCATCAACCCCTGCACCACCACCACCACCACCACCACCTCGATTTCCGAACCTTCTAGATTCTTCGATGCAACCACCCCCGCCACTTCATCGCGCTCCCCAAAGCGATCCCTCCCTCTCGACGAGGAATCTCAGACGGACCAAACGACGTCTTCTGAGCCCAAACGCGCCGTGAACCGCTGCTCCGGCTGCCGGCGGCGCGTGGGACTCACGGGATTCCGGTGCCGCTGCGGGGACCTTTTCTGCGCAGAGCACCGCTACTCCGACCGCCACGACTGCTCCTACGACTACAAGGCCGCGGGGAGAGAGGCCATCGCGAGAGAGAACCCCGTCGTGAAGGCCGCGAAGATCGTCAAAGTCTGA

Predicted protein sequences of Glyma13g27410

Limit To All Plant Sequences

>Glyma13g27410.2   sequence type=predicted peptide   gene model=Glyma13g27410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQKAQKNDTEFKVPEPIINPCTTTTTTTTSISEPSRFFDATTPATSSRSPKRSLPLDEESQTDQTTSSEPKRAVNRCSGCRRRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENPVVKAAKIVKV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain