SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma13g27260

Feature Type:gene_model
Chromosome:Gm13
Start:30435681
stop:30437424
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G07985AT Annotation by Michelle Graham. TAIR10: Expressed protein | chr1:2475508-2475942 FORWARD LENGTH=144 SoyBaseE_val: 1.00E-15ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1M0X9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M0X9_SOYBN SoyBaseE_val: 9.00E-94ISS
UniRef100_Q9LN08UniRef Annotation by Michelle Graham. Most informative UniRef hit: T6D22.8 n=1 Tax=Arabidopsis thaliana RepID=Q9LN08_ARATH SoyBaseE_val: 1.00E-11ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g36580 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g202600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g27260.1   sequence type=CDS   gene model=Glyma13g27260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCCACCGAGGAACCAATTCTCTCTAGGATTGACCGTTTGGATAATATGTTGAGGCAATTGGAGGTAATCAGAGGGTGCAATCCATCTCCAAAGAGCTCGTGTGCATCTACTCCAACAAGTGGAAGTGATGGACACGTGTCATCCACTGATTTCTCCCCAAAGAGTTTAGAGAAGCACTGCCGTCCGATTGAATTCGTGATGATGGAGACCGAAGTCAAAGGAACGATGATAGAGAGGCTCAACCAAGTGGAGGATCGAATGCTAAAGCTGGAGGAAGAGTTGGTAGCAAAGAAGAAAGAGGAAGAGAAGAAAATGAATAGCCCGAAGAAGGGTTTTAAACAGCTTGTGAAGCAATGTGTGAAAGCTAGGGGAAAATATAGTACTAATAATAAACAAGCATGA

>Glyma13g27260.1   sequence type=predicted peptide   gene model=Glyma13g27260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAATEEPILSRIDRLDNMLRQLEVIRGCNPSPKSSCASTPTSGSDGHVSSTDFSPKSLEKHCRPIEFVMMETEVKGTMIERLNQVEDRMLKLEEELVAKKKEEEKKMNSPKKGFKQLVKQCVKARGKYSTNNKQA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo