Glyma13g27120 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g27120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g27120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g27120

Feature Type:	gene_model
Chromosome:	Gm13
Start:	30293435
stop:	30295249
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g27120

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G39130	AT	Annotation by Michelle Graham. TAIR10: Dehydrin family protein \| chr4:18228183-18228844 REVERSE LENGTH=151	SoyBase	E_val: 3.00E-10	ISS
GO:0009415	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water stimulus	SoyBase	N/A	ISS
GO:0009827	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification	SoyBase	N/A	ISS
GO:0009860	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen tube growth	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF00257	PFAM	Dehydrin	JGI		ISS
UniRef100_I1M0W1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M0W1_SOYBN	SoyBase	E_val: 3.00E-94	ISS
UniRef100_O23957	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Dehydrin n=2 Tax=Glycine max RepID=O23957_SOYBN	SoyBase	E_val: 1.00E-18	ISS

Expression Patterns of Glyma13g27120

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g27120 not represented in the dataset	Glyma13g27120 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g27120

Paralog	Evidence	Comments
Glyma12g36430	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g27120 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g201300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g27120

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g27120

Limit To All Plant Sequences

>Glyma13g27120.1   sequence type=CDS   gene model=Glyma13g27120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACAAGTTGAACTGCGAGATGAGCATGGGAACCCAGTTGAACTCACAGATGCATATGGGAATCCGGTTTGGTTAACGGACGAGAAAGGCAAACCGGTGCACCTCACCGGTGTGGCAACCACTGCACACAAATGTTTGCAAGAGAATGACACACCACAAGAGCTTCCTCACTCCAAGAGCTCAAGCTCTAGCTCTTCTGAGGATGAAGAGCATGGAGGGAGGAGCAAGAAGGGACTGAAGGATAAAATAGAAGAGAAGTTGCCAGGAGGAGAAGAAGGAGAGGGAAAGGAGCATGCACACACCACAACAGTTACTTCTGCTACTACCACAGATAGTGGTGCTAATCACCACCCAACCACAACCACTGACCATGAGAAGAAGAGTATAATAGACAAGATTAAAGAAAAATTCCAATAA

Predicted protein sequences of Glyma13g27120

Limit To All Plant Sequences

>Glyma13g27120.1   sequence type=predicted peptide   gene model=Glyma13g27120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQVELRDEHGNPVELTDAYGNPVWLTDEKGKPVHLTGVATTAHKCLQENDTPQELPHSKSSSSSSSEDEEHGGRSKKGLKDKIEEKLPGGEEGEGKEHAHTTTVTSATTTDSGANHHPTTTTDHEKKSIIDKIKEKFQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain