Glyma13g26770 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g26770

Feature Type:	gene_model
Chromosome:	Gm13
Start:	29987894
stop:	29990133
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g26770

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G41310	AT	Annotation by Michelle Graham. TAIR10: response regulator 3 \| chr2:17222280-17223536 FORWARD LENGTH=225	SoyBase	E_val: 5.00E-71	ISS
GO:0000160	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007623	GO-bp	Annotation by Michelle Graham. GO Biological Process: circadian rhythm	SoyBase	N/A	ISS
GO:0009736	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway	SoyBase	N/A	ISS
GO:0010029	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of seed germination	SoyBase	N/A	ISS
GO:0031537	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin metabolic process	SoyBase	N/A	ISS
GO:0048831	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of shoot development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0000156	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR26402	Panther	RESPONSE REGULATOR OF TWO-COMPONENT SYSTEM	JGI		ISS
PTHR26402:SF52	Panther		JGI		ISS
PF00072	PFAM	Response regulator receiver domain	JGI		ISS
UniRef100_I1M0T1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M0T1_SOYBN	SoyBase	E_val: 3.00E-128	ISS
UniRef100_Q1RU46	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Response regulator receiver n=1 Tax=Medicago truncatula RepID=Q1RU46_MEDTR	SoyBase	E_val: 1.00E-100	ISS

Proteins Associated with Glyma13g26770

Locus	Gene Symbol	Protein Name
	RR18	Root specific, Response Regulator Type-A

Expression Patterns of Glyma13g26770

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g26770

Paralog	Evidence	Comments
Glyma15g37770	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g26770 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g197600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g26770

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g26770

Limit To All Plant Sequences

>Glyma13g26770.1   sequence type=CDS   gene model=Glyma13g26770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTATGACTGTGGAGGCTCAGTTCCATGTTTTGGCTGTTGATGACAGTATTATTGACAGAATGCTGATTGAGAGGCTCCTAAAAACCTCTTCCTTTCATGTTACTACACTGGACTCTGCCACTAAGGCCTTAAAATTTCTTGGTTTGGTTGAAGATGAGTTGCGGACTTTTGACACTACTGTTGCATCAGAAATTCATCAGGATGTAGATGTAAACTTGATTATAACAGATTACTGCATGCCAGGACTGACTGGCTATGATCTGCTGAGAAAAATCAAGGAATCTAAATCTCTTAAAAACATACCAGTTGTGATTATGTCCTCAGAGAATGTACCATCAAGGATCAACAGATGCTTGGAAGAGGGTGCAGAAGAATTCTTTCTGAAACCAGTTCAACAGGCAGATGTGAACAAGCTGAAACCTCACTTGATGAAATCAAGAGCTAAGGAAGAGCAAGACCAGCCCTTCAATAACAAAAGGAAGGACATGAAGGAAATCCACTCCCCAAATAAAACCAGGATAAAATGTAGCAGTTAA

Predicted protein sequences of Glyma13g26770

Limit To All Plant Sequences

>Glyma13g26770.1   sequence type=predicted peptide   gene model=Glyma13g26770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMTVEAQFHVLAVDDSIIDRMLIERLLKTSSFHVTTLDSATKALKFLGLVEDELRTFDTTVASEIHQDVDVNLIITDYCMPGLTGYDLLRKIKESKSLKNIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQQADVNKLKPHLMKSRAKEEQDQPFNNKRKDMKEIHSPNKTRIKCSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain