SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g26621): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g26621): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g26621

Feature Type:gene_model
Chromosome:Gm13
Start:29800299
stop:29800662
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g26621
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G78270AT Annotation by Michelle Graham. TAIR10: UDP-glucosyl transferase 85A4 | chr1:29450691-29452223 REVERSE LENGTH=489 SoyBaseE_val: 1.00E-45ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0008194GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity SoyBaseN/AISS
GO:0015020GO-mf Annotation by Michelle Graham. GO Molecular Function: glucuronosyltransferase activity SoyBaseN/AISS
GO:0016758GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups SoyBaseN/AISS
PTHR11926Panther GLUCOSYL/GLUCURONOSYL TRANSFERASES JGI ISS
PTHR11926:SF15Panther UDP-GLUCURONOSYLTRANSFERASE RELATED JGI ISS
UniRef100_B9RJL8UniRef Annotation by Michelle Graham. Most informative UniRef hit: UDP-glucuronosyltransferase, putative n=1 Tax=Ricinus communis RepID=B9RJL8_RICCO SoyBaseE_val: 4.00E-47ISS
UniRef100_UPI000233C1A1UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C1A1 related cluster n=1 Tax=unknown RepID=UPI000233C1A1 SoyBaseE_val: 1.00E-74ISS

Expression Patterns of Glyma13g26621
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g26621 not represented in the dataset
Glyma13g26621 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g26621 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g196400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g26621
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g26621
>Glyma13g26621.1   sequence type=CDS   gene model=Glyma13g26621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAAGCTTCATGCTGTGTGCATCCCATACCCAGCACAAGGCCACATAAACCCAATGCTCAAGCTAGCAAAACTCCTTCATGTTAGAGGCTTCCACGTCACCTTTGTTAACACAGAGTACAACCACAAACGCTTTCTCAAATCAAGAGGTCCTAATTCCCTCAATAGTGTCACATCATTTCAATTTGAAACCATCCCTGATGGTCTCTCTGATAACCCTAATGTTGATGCCACACAGGACACAGTTTCTTTATGTGATTCTACTAGAAAGACTTGCTTAAGTCCTTTCGAATACCTCCTTTCTAAACTCAATAGTGAACCATCACTTCACATGTGA
Predicted protein sequences of Glyma13g26621
>Glyma13g26621.1   sequence type=predicted peptide   gene model=Glyma13g26621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKLHAVCIPYPAQGHINPMLKLAKLLHVRGFHVTFVNTEYNHKRFLKSRGPNSLNSVTSFQFETIPDGLSDNPNVDATQDTVSLCDSTRKTCLSPFEYLLSKLNSEPSLHM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo