Glyma13g26290 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g26290

Feature Type:	gene_model
Chromosome:	Gm13
Start:	29509759
stop:	29510353
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g26290

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF05678	PFAM	VQ motif	JGI		ISS
UniRef100_B6TMN6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: VQ motif family protein n=1 Tax=Zea mays RepID=B6TMN6_MAIZE	SoyBase	E_val: 7.00E-08	ISS
UniRef100_C6SZL1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SZL1_SOYBN	SoyBase	E_val: 3.00E-80	ISS

Proteins Associated with Glyma13g26290

Locus	Gene Symbol	Protein Name
	VQ54	VQ motif containing protein gene 54

Expression Patterns of Glyma13g26290

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g26290

Paralog	Evidence	Comments
Glyma15g37230	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g26290 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g193800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g26290

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g26290

Limit To All Plant Sequences

>Glyma13g26290.3   sequence type=CDS   gene model=Glyma13g26290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCGACAACAAAAGGGACAAAAAGGATATCAAAGTTACATATATTTCGAGCCCCGTGAAGGTGAAGACTAGTGCCTCGAATTTCAGGGCCCTTGTGCAAGAACTCACTGGCCAATACTCCAATGTTGCTGAAACCTCCATGCCTATGGAAGAAGAAGAAAATGGCCATTCCGAGAGAGTGCACAAAACTCATCTTCTTCATGAAAGTGAAACTCAACTATGGAGGGTGGATGTTGATGAGGGCACCAATTTGATGAAACCTCTTGAGTATAGTGAGTACCTCTCAAGATCCTTGATGGAGCCATTCAACCAACAACAACACCTTCAATACGATTTGTTGAGTTTTGACATGTCATAG

Predicted protein sequences of Glyma13g26290

Limit To All Plant Sequences

>Glyma13g26290.3   sequence type=predicted peptide   gene model=Glyma13g26290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVDNKRDKKDIKVTYISSPVKVKTSASNFRALVQELTGQYSNVAETSMPMEEEENGHSERVHKTHLLHESETQLWRVDVDEGTNLMKPLEYSEYLSRSLMEPFNQQQHLQYDLLSFDMS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain