Glyma13g26260 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g26260

Feature Type:	gene_model
Chromosome:	Gm13
Start:	29469175
stop:	29476007
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g26260

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G38730	AT	Annotation by Michelle Graham. TAIR10: Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein \| chr2:16192579-16194038 REVERSE LENGTH=199	SoyBase	E_val: 5.00E-109	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003755	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity	SoyBase	N/A	ISS
KOG0879	KOG	U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase	JGI		ISS
PTHR11071	Panther	CYCLOPHILIN	JGI		ISS
PTHR11071:SF58	Panther	PEPTIDYL-PROLYL CIS-TRANS ISOMERASE H, PPIH	JGI		ISS
PF00160	PFAM	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD	JGI		ISS
UniRef100_I1M0N8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=I1M0N8_SOYBN	SoyBase	E_val: 3.00E-129	ISS
UniRef100_I1M0N8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=I1M0N8_SOYBN	SoyBase	E_val: 3.00E-129	ISS

Expression Patterns of Glyma13g26260

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g26260

Paralog	Evidence	Comments
Glyma09g11960	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma15g37190	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g26260 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g193500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g26260

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g26260

Limit To All Plant Sequences

>Glyma13g26260.1   sequence type=CDS   gene model=Glyma13g26260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGTTCAATTGGAAGCGGAGGGAACACAAGCACGGGTGTGGAGTGGCACGTGCGACCTCCAAACCCTAAGAATCCCATCGTCTTCTTCGATGTCACCATCGGTAACATTCCCGCCGGTCGAATCAAGATGGAACTCTTCGCCGATATTGCCCCCAAAACTGCCGAGAATTTCAGGCAGTTCTGCACTGGGGAATACAGGAAAGCAGGACTGCCTGTTGGTTACAAGGGTTGTCAATTTCATAGAGTTATTAAGGATTTTATGATTCAGGCTGGTGATTTTGTAAAGGGAGATGGTAGTGGATGTGTTTCCATCTATGGACTCAAGTTTGATGATGAAAACTTTACGGCCAAACACACTGGTCCTGGCCTTCTGTCGATGGCAAATAGCGGACAAAATACCAATGGCTGTCAGTTCTTTATAACATGTGCAAAATGTGACTGGCTTGACAACAAGCATGTTGTCTTTGGGAGAGTGCTGGGAGATGGTCTTTTGGTTGTCAGGAAGATTGAGAACGTGGCAACCGGGACCCAATAA

Predicted protein sequences of Glyma13g26260

Limit To All Plant Sequences

>Glyma13g26260.1   sequence type=predicted peptide   gene model=Glyma13g26260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGSIGSGGNTSTGVEWHVRPPNPKNPIVFFDVTIGNIPAGRIKMELFADIAPKTAENFRQFCTGEYRKAGLPVGYKGCQFHRVIKDFMIQAGDFVKGDGSGCVSIYGLKFDDENFTAKHTGPGLLSMANSGQNTNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGTQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain