SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g26020

Feature Type:gene_model
Chromosome:Gm13
Start:29248273
stop:29248917
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g26020
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G65620AT Annotation by Michelle Graham. TAIR10: Lateral organ boundaries (LOB) domain family protein | chr1:24400146-24400745 FORWARD LENGTH=199 SoyBaseE_val: 6.00E-74ISS
GO:0009799GO-bp Annotation by Michelle Graham. GO Biological Process: specification of symmetry SoyBaseN/AISS
GO:0009943GO-bp Annotation by Michelle Graham. GO Biological Process: adaxial/abaxial axis specification SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0009954GO-bp Annotation by Michelle Graham. GO Biological Process: proximal/distal pattern formation SoyBaseN/AISS
GO:0010305GO-bp Annotation by Michelle Graham. GO Biological Process: leaf vascular tissue pattern formation SoyBaseN/AISS
GO:0048441GO-bp Annotation by Michelle Graham. GO Biological Process: petal development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005654GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleoplasm SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF03195PFAM Protein of unknown function DUF260 JGI ISS
UniRef100_A7L4B2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Asymmetric leaves 2 n=1 Tax=Carica papaya RepID=A7L4B2_CARPA SoyBaseE_val: 2.00E-85ISS
UniRef100_UPI000233D798UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D798 related cluster n=1 Tax=unknown RepID=UPI000233D798 SoyBaseE_val: 4.00E-157ISS

Expression Patterns of Glyma13g26020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g26020
ParalogEvidenceComments
Glyma15g36310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g26020 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g191000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g26020
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g26020
>Glyma13g26020.2   sequence type=CDS   gene model=Glyma13g26020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCTTCAAATTCACCATGTGCAGCATGCAAGTTCTTGCGTCGCAAATGCCAACCTGAGTGTGCATTTGCACCATATTTTCCCCCTGACCAGCCTCAAAAGTTTGCAAATGTTCATAGAATTTTTGGGGCAAGCAATGTCACAAAGCTTCTCAACGACTTGCACCCTCACCAACGTGAAGATGCTGTCAATTCCCTTGCTTATGAAGCTGAGATGAGGCTCCGTGACCCTGTCTATGGTTGTGTAGGAGTCATATCACTCTTACAACACCAACTTCGCCAGCTTCAAATGGACCTCTATTGTGCGAAATCCGAGCTCTCGAGGTACCAAAACTTGAGCATCACCACCAATTTGAGCTCTCTAGCTTCCGAGTCCGCGACCACGGCCTATCATCACCATCACCAGAACATGTCTGGTGCTGGTGCTGGTGCCGGCCGTGACCATCATTATCACTATCATCGCCATCATCAGTTCTTTCCAAGGGACCAACACCAACAACAACAAGTGGTGAGAAGCTTTGATGCCGGCAACAACTATGATGCAAGTCTTTTGGCCATGAACATATCCGCCAACTTAGGGCAACTCAACCAGCTTCAGCATCATAGTGCAGCTGGCGGGGGCGACGACCGCAACTGCTCCTAG
Predicted protein sequences of Glyma13g26020
>Glyma13g26020.2   sequence type=predicted peptide   gene model=Glyma13g26020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSNSPCAACKFLRRKCQPECAFAPYFPPDQPQKFANVHRIFGASNVTKLLNDLHPHQREDAVNSLAYEAEMRLRDPVYGCVGVISLLQHQLRQLQMDLYCAKSELSRYQNLSITTNLSSLASESATTAYHHHHQNMSGAGAGAGRDHHYHYHRHHQFFPRDQHQQQQVVRSFDAGNNYDASLLAMNISANLGQLNQLQHHSAAGGGDDRNCS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo