Glyma13g25900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g25900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g25900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g25900

Feature Type:	gene_model
Chromosome:	Gm13
Start:	29134000
stop:	29134994
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g25900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G27320	AT	Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein \| chr5:9629254-9630746 FORWARD LENGTH=344	SoyBase	E_val: 1.00E-27	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009939	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0010325	GO-bp	Annotation by Michelle Graham. GO Biological Process: raffinose family oligosaccharide biosynthetic process	SoyBase	N/A	ISS
GO:0010476	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellin mediated signaling pathway	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0048444	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ morphogenesis	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
KOG1515	KOG	Arylacetamide deacetylase	JGI		ISS
PTHR23024	Panther	MEMBER OF 'GDXG' FAMILY OF LIPOLYTIC ENZYMES	JGI		ISS
PTHR23024:SF10	Panther	CARBOXYLESTERASE-RELATED	JGI		ISS
PF07859	PFAM	alpha/beta hydrolase fold	JGI		ISS
UniRef100_D5LG62	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: HSR203J protein n=1 Tax=Arachis hypogaea RepID=D5LG62_ARAHY	SoyBase	E_val: 5.00E-124	ISS
UniRef100_I1M0K6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M0K6_SOYBN	SoyBase	E_val: 4.00E-139	ISS

Expression Patterns of Glyma13g25900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g25900 not represented in the dataset	Glyma13g25900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g25900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g189800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g25900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g25900

Limit To All Plant Sequences

>Glyma13g25900.2   sequence type=CDS   gene model=Glyma13g25900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCCAAGAGAAGAAGCTCGTGGACGAAGTGTCGGGTTGGCTGAGACTCTACGAAGACGGTTCAGTAGACCGGACTTGGACCGGTTCGCCAGAAGTTAAATTCTTGGTTGGGCCGGAGAAGCTACCCATTTTCCTCCACTTCCATGGTGGGGGATTTTGCATAAGCGAACCGGACTGGTTCATAGGGAGCCGTGGCTCAAAAAAACATGGCAATTTTGGCCGTGTTTTTCTTATAGGAGATAGCTCAGGTGGAAATATTGTGCATGAAGTTGCTGTCCGTGCCGGGGAGGCTAAGTTGGACCTGCTCCATCTCGCCGGAGGAATCCCGATACATCCGGGGTTCATGCGGTCGAAACGGAGTAGGTCAGAGTTGGAGAAACCACAATCTCCATTCTTGACGTTGGACATGGTGGACAAGTTCATGAGCTTGGCATTGCCATTGGGTTCTAACAAGGACCACCCCATTGCATGCCCCATGGGAGGCGGCGCTCCGCCGCTTAGCGGGCTGAAACTGCCGCCGATTCTGCTGTGCCTGGCGGAGATGGACTTGATCTTTGACACAGAGATGGAGTACAACGAAGCCATGAAGAAGGCCAACAAAGATGTGGAGTTGTTTGTTAACAAAGGAGCGACTCATAGTTTCTATCTCAACAAAATTGCGGTGGATATGGACCCAAATACTGGTGCTCAAACGGAGGCTCTTATTGCAAGGATCAAAGAGTTCATTGAGCAGCACTAA

Predicted protein sequences of Glyma13g25900

Limit To All Plant Sequences

>Glyma13g25900.2   sequence type=predicted peptide   gene model=Glyma13g25900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVQEKKLVDEVSGWLRLYEDGSVDRTWTGSPEVKFLVGPEKLPIFLHFHGGGFCISEPDWFIGSRGSKKHGNFGRVFLIGDSSGGNIVHEVAVRAGEAKLDLLHLAGGIPIHPGFMRSKRSRSELEKPQSPFLTLDMVDKFMSLALPLGSNKDHPIACPMGGGAPPLSGLKLPPILLCLAEMDLIFDTEMEYNEAMKKANKDVELFVNKGATHSFYLNKIAVDMDPNTGAQTEALIARIKEFIEQH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain