SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g25765): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g25765): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g25765

Feature Type:gene_model
Chromosome:Gm13
Start:28981805
stop:28988449
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g25765
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12300AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF667 (InterPro:IPR007714); Has 373 Blast hits to 371 proteins in 116 species: Archae - 0; Bacteria - 0; Metazoa - 213; Fungi - 4; Plants - 71; Viruses - 0; Other Eukaryotes - 85 (source: NCBI BLink). | chr3:3921787-3923092 REVERSE LENGTH= SoyBaseE_val: 4.00E-101ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3213 KOG Transcription factor IIB JGI ISS
PTHR12458Panther ORF PROTEIN JGI ISS
PF05018PFAM Protein of unknown function (DUF667) JGI ISS
UniRef100_B3TLX8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor IIB n=1 Tax=Elaeis guineensis RepID=B3TLX8_ELAGV SoyBaseE_val: 3.00E-105ISS
UniRef100_UPI000233BAB8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BAB8 related cluster n=1 Tax=unknown RepID=UPI000233BAB8 SoyBaseE_val: 3.00E-112ISS

Expression Patterns of Glyma13g25765
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g25765 not represented in the dataset
Glyma13g25765 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g25765 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma13g25765
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g25765
>Glyma13g25765.1   sequence type=CDS   gene model=Glyma13g25765   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCAAGAACACATTCCAATCTGGATTTCTTTCCATTTTGTACAGCCTTGGTAGTAAACCTTTGCAAATATGGGACAAAGAAGTTGTGAATGGCCATGTTGAACGACCACAGGATGAAGACATACAATCCAATGTACTGGAAATAATTGGATCAAATATTCAGTCCACATACATTACGTGCCCAGCTGACCCAGCTGCAACACTTGGTATAAAACTTCCATTCTTGGTTTTGATTGTCAAGAATCTAATGAAGTATTTCACATTTGAGATTCAAGTTTTGGATGATAAGAATGTCAGGCGACGATTTCGAGCCTCAAATTTTCAATTTAACCTGGCTGATTTCACCAAGAGAGCATATGGTACTAATTATGTGGAGACACTGCAAGTTCAGGTACATGCAAACTGTCGCCTGAGAAGGATTTACTTCTCTGACCGCCTCTACTCTGAAGAGGAACTCCCTCCAGAGTTCAAATTGTACCTTCCAATGCAGGTTAGACTTTAG
Predicted protein sequences of Glyma13g25765
>Glyma13g25765.1   sequence type=predicted peptide   gene model=Glyma13g25765   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFKNTFQSGFLSILYSLGSKPLQIWDKEVVNGHVERPQDEDIQSNVLEIIGSNIQSTYITCPADPAATLGIKLPFLVLIVKNLMKYFTFEIQVLDDKNVRRRFRASNFQFNLADFTKRAYGTNYVETLQVQVHANCRLRRIYFSDRLYSEEELPPEFKLYLPMQVRL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo