SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g25266): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g25266): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g25266

Feature Type:gene_model
Chromosome:Gm13
Start:28516540
stop:28519102
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G61120AT Annotation by Michelle Graham. TAIR10: terpene synthase 04 | chr1:22523689-22528598 FORWARD LENGTH=877 SoyBaseE_val: 5.00E-75ISS
GO:0000304GO-bp Annotation by Michelle Graham. GO Biological Process: response to singlet oxygen SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0016102GO-bp Annotation by Michelle Graham. GO Biological Process: diterpenoid biosynthetic process SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0080027GO-bp Annotation by Michelle Graham. GO Biological Process: response to herbivore SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0010333GO-mf Annotation by Michelle Graham. GO Molecular Function: terpene synthase activity SoyBaseN/AISS
GO:0016829GO-mf Annotation by Michelle Graham. GO Molecular Function: lyase activity SoyBaseN/AISS
GO:0080013GO-mf Annotation by Michelle Graham. GO Molecular Function: (E,E)-geranyllinalool synthase activity SoyBaseN/AISS
PF01397PFAM Terpene synthase, N-terminal domain JGI ISS
UniRef100_E5GAI0UniRef Annotation by Michelle Graham. Most informative UniRef hit: P(E)-nerolidol/(E,E)-geranyl linalool synthase n=1 Tax=Vitis vinifera RepID=E5GAI0_VITVI SoyBaseE_val: 1.00E-122ISS
UniRef100_I1M0E7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M0E7_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g25266 not represented in the dataset

Glyma13g25266 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g25266.1   sequence type=CDS   gene model=Glyma13g25266   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTCTCCTTCATCCTCCCTCGTTGAAAAGATTAAGGGGAAAATATTCTCATCAAATGTTGATCCCTATACTTCTATATGCCCCTCAGCTTATGATACTGCATGGTTAGCAATGATACCTGATTCCCACAATTCTTTCAAACCCATGTTCAAAAACTGCTTGGACTGGCTTCTCAACAACCAAAATCAACAAGGGTTTTGGGGTGAGTGTGATGCCTTTGGAAAACCCACATTGGAAACACTTCCGGCAACCCTAGCTTCCATTGTTGCACTCAAAAAGTGGAACACCGGTGCATTAATGATAGACACAGGTTTGGTCTTCATTGAAACAAATATTGAAAAGCTGCTCAAGGATATCGACAACAATTGTCCTCGTTGGTTTAGGATTGTTTTTCCAGCCATGGTTCAACTTTCAGAGAGTGTTGGTTTAGAAATTGTGTTCCCAGATGCAGTGACAGGGTCTGTGTCAAGGATCTTTCACCGTCAACAATATCTTCTTAACAAGGAGGAACTTGTGGGGAAGCATTGCTTCCCACCACTGTTATCATATCTTGAAGCTTTGCCACCTACATATACAATAAGTGAAGAAGATATACGTAGCAATCTCAGTGATGATGGTTCAGTGTTCCAATCACCCTCTGCTACTGCAAAAGCTTTCATGGCTACTGGGAAGATTGAGTGTCTGGCCTATTTACAGTCTCTAATTCAAAGATGTCCTGATGGAGTTCCACAAACGTACCCCATGGACGAGGAACTTATAAAGCTTTGCATGGTAAACAAATTACAAAGGCTAGGGTTGGCTGAGCACTTCGTTGAAGAGATTGATGAAATTTTGGCCAAGGTCTACAGGTAA

>Glyma13g25266.1   sequence type=predicted peptide   gene model=Glyma13g25266   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESPSSSLVEKIKGKIFSSNVDPYTSICPSAYDTAWLAMIPDSHNSFKPMFKNCLDWLLNNQNQQGFWGECDAFGKPTLETLPATLASIVALKKWNTGALMIDTGLVFIETNIEKLLKDIDNNCPRWFRIVFPAMVQLSESVGLEIVFPDAVTGSVSRIFHRQQYLLNKEELVGKHCFPPLLSYLEALPPTYTISEEDIRSNLSDDGSVFQSPSATAKAFMATGKIECLAYLQSLIQRCPDGVPQTYPMDEELIKLCMVNKLQRLGLAEHFVEEIDEILAKVYR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo