SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g24780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g24780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g24780

Feature Type:gene_model
Chromosome:Gm13
Start:28103691
stop:28107341
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G22870AT Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr2:9739476-9740921 FORWARD LENGTH=300 SoyBaseE_val: 8.00E-150ISS
GO:0000917GO-bp Annotation by Michelle Graham. GO Biological Process: barrier septum assembly SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG2486 KOG Predicted GTPase JGI ISS
PTHR11649Panther MSS1/TRME-RELATED GTP-BINDING PROTEIN JGI ISS
PF01926PFAM GTPase of unknown function JGI ISS
UniRef100_B9SH28UniRef Annotation by Michelle Graham. Most informative UniRef hit: GTP-binding protein engB, putative n=1 Tax=Ricinus communis RepID=B9SH28_RICCO SoyBaseE_val: 3.00E-153ISS
UniRef100_I1KLK2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KLK2_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g24780 not represented in the dataset

Glyma13g24780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g31670 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g179400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g24780.2   sequence type=CDS   gene model=Glyma13g24780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGCGCTGGTGAGAAGTGGAGTGATGAAGCTCACTCTCCAATTCCAAACCCCTTCTCCTTCTCTGTCTCTCTTCTCTTCTTCTCTCTCCATTACCAAAACACCATCACCACCCTCTTTCTTCTCCTTCCGCCACCCTCTTTCCCATTCGAGCAACGCTTCCAAAACCCCCACCACCAACCCTCTTCCTTCTTCTTCCTTTGAATCCCAGCTATTCATCCCTCCGGGCATTGAACCCGACGAGGTCGACGACTCCACGGTCCTTCCCGGCTCCAACATCGCCGTCGGACCCTACGCCGGCGATTCCCGAATCAAGGACGTCCAGTTCGTCAAGAGCAGCGCCCGCGCCAGGGATTGCCCCAAAGACGACCTACCCGAATTCGCCGTTCTCGGTCGCTCCAACGTCGGCAAATCCTCCCTCATCAATTCCCTCGTCCGCAAGAAAGAGATTGCTCTCACTTCCAAGAAACCAGGGAAGACGCAGCTCATCAATCACTTCTTGGTCAACAAAAGCTGGTACCTTGTTGACTTGCCTGGTTACGGCTTTGCTAAAGCACCTGAAGCAGCAAAAACGGATTGGTCCTCATTCACAAAAGGGTACTTTTTGAACAGAAGTACTCTGGTTGCTGTCTTGCTTCTCATTGATGCAAGTGTTCCACCCCAAAAAGTTGACTTGGATTGTGCAAATTGGCTTGGACGCAATAATATACCAATCACTTTTGTTTTCACAAAATGTGACAAAATGAAGGTGGCAAAAGGGAAACGGCCCGATGAGAACATAAGGGATTTTCAAGAGTTAATCAGACAAAACTACAAGCAACATCCTCCATGGATTATGACCAGCAGTGTCACTGGAATGGGTAGAGATGAGCTTCTCTTGCATATGTCTCAGCTAAGAAACTACTGGGATCAGTAG

>Glyma13g24780.2   sequence type=predicted peptide   gene model=Glyma13g24780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTALVRSGVMKLTLQFQTPSPSLSLFSSSLSITKTPSPPSFFSFRHPLSHSSNASKTPTTNPLPSSSFESQLFIPPGIEPDEVDDSTVLPGSNIAVGPYAGDSRIKDVQFVKSSARARDCPKDDLPEFAVLGRSNVGKSSLINSLVRKKEIALTSKKPGKTQLINHFLVNKSWYLVDLPGYGFAKAPEAAKTDWSSFTKGYFLNRSTLVAVLLLIDASVPPQKVDLDCANWLGRNNIPITFVFTKCDKMKVAKGKRPDENIRDFQELIRQNYKQHPPWIMTSSVTGMGRDELLLHMSQLRNYWDQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo