Glyma13g24290 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g24290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g24290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g24290

Feature Type:	gene_model
Chromosome:	Gm13
Start:	27671980
stop:	27673619
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g24290

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G24740	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1162) \| chr5:8486432-8489703 REVERSE LENGTH=389	SoyBase	E_val: 1.00E-42	ISS
GO:0006396	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA processing	SoyBase	N/A	ISS
GO:0008104	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein localization	SoyBase	N/A	ISS
GO:0009887	GO-bp	Annotation by Michelle Graham. GO Biological Process: organ morphogenesis	SoyBase	N/A	ISS
GO:0009888	GO-bp	Annotation by Michelle Graham. GO Biological Process: tissue development	SoyBase	N/A	ISS
GO:0010413	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process	SoyBase	N/A	ISS
GO:0010638	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization	SoyBase	N/A	ISS
GO:0022402	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell cycle process	SoyBase	N/A	ISS
GO:0033044	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization	SoyBase	N/A	ISS
GO:0045492	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
PTHR16166	Panther	VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN (VPS13)	JGI		ISS
PTHR16166:SF7	Panther	gb def: tipc protein - slime mold (dictyostelium discoideum)	JGI		ISS
UniRef100_I1M060	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M060_SOYBN	SoyBase	E_val: 7.00E-86	ISS
UniRef100_Q9FT44	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: VPS13-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9FT44_ARATH	SoyBase	E_val: 2.00E-39	ISS

Expression Patterns of Glyma13g24290

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g24290 not represented in the dataset	Glyma13g24290 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g24290 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g24290

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g24290

Limit To All Plant Sequences

>Glyma13g24290.1   sequence type=CDS   gene model=Glyma13g24290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAAGTACTATTGGAGAATGTGGAGCTGATACTTGACGCATTTGATTATCTCCAACTTCCATTTGCACTAAAGCAAGGTCGAGTTGGGAAGTTAAGCATAAAAATTCCGTGGAAGAAGCCTTGGGACCCCATTATAATCATTTTAGAGGATGTCTTTATTTCTGCATCACAGCGAGGCGATCAAGAGTGGAGTGCTGACGCTGTTGAACAAAGAGAATTTGCTGGAAAAAAGGCCAAGCTAGCAGCAGCGGAGTTGGGAAAATTATCCAGAAGGAACTTTGATAGAAGGCCTCAAGAGGGGGTTACCTCTGTATTCAAAGAAGTAAAAACTGAAATTTTCTTCTGTATGATATCAATCCTTAAGCTCCATCTCCCTCTACCTGTA

Predicted protein sequences of Glyma13g24290

Limit To All Plant Sequences

>Glyma13g24290.1   sequence type=predicted peptide   gene model=Glyma13g24290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
EVLLENVELILDAFDYLQLPFALKQGRVGKLSIKIPWKKPWDPIIIILEDVFISASQRGDQEWSADAVEQREFAGKKAKLAAAELGKLSRRNFDRRPQEGVTSVFKEVKTEIFFCMISILKLHLPLPV

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain