Glyma13g23940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g23940

Feature Type:	gene_model
Chromosome:	Gm13
Start:	27238099
stop:	27241602
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g23940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G05780	AT	Annotation by Michelle Graham. TAIR10: Vacuolar ATPase assembly integral membrane protein VMA21-like domain \| chr1:1726761-1728180 FORWARD LENGTH=106	SoyBase	E_val: 7.00E-41	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF09446	PFAM	VMA21-like domain	JGI		ISS
UniRef100_I1M025	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M025_SOYBN	SoyBase	E_val: 3.00E-69	ISS
UniRef100_Q58G56	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar ATPase assembly integral membrane protein VMA21-like domain-containing protein n=1 Tax=Arabidopsis thaliana RepID=Q58G56_ARATH	SoyBase	E_val: 3.00E-38	ISS

Expression Patterns of Glyma13g23940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g23940

Paralog	Evidence	Comments
Glyma19g01350	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g23940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g170400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g23940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g23940

Limit To All Plant Sequences

>Glyma13g23940.1   sequence type=CDS   gene model=Glyma13g23940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGTTATTCAGAAGTTTTTCGTTGCATCACTGTTCATGTGGGCAATTCCTATTGCAATATTATATGCTTTTAACCATAATATACTTCCTGGAGCATCCAATTTGTCCCCTTACTCTATGACACTAGTGAGTGGATTTCTTGCTGTCATATCTGTCAATGTGGTGATAGCATTTTACATATATTTGGCATTGAGAGAACCTACGGCGGATAAACCCGAGCCTGATCCTAAATTTCTTGCTGAGGCCAAAGCTAGCATCAATCAGTCTACAGGGGATGCTCAACAACCTTCCCAGGCTCTCAAGAAAGAACAGTAG

Predicted protein sequences of Glyma13g23940

Limit To All Plant Sequences

>Glyma13g23940.1   sequence type=predicted peptide   gene model=Glyma13g23940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVIQKFFVASLFMWAIPIAILYAFNHNILPGASNLSPYSMTLVSGFLAVISVNVVIAFYIYLALREPTADKPEPDPKFLAEAKASINQSTGDAQQPSQALKKEQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain