Report for Sequence Feature Glyma13g23930
Feature Type: gene_model
Chromosome: Gm13
Start: 27235111
stop: 27236512
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g23930
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G48030 AT
Annotation by Michelle Graham. TAIR10: hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein | chr3:17725410-17727954 REVERSE LENGTH=349
SoyBase E_val: 5.00E-17 ISS
GO:0001666 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to hypoxia
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
PTHR14155 Panther
RING FINGER PROTEIN 6/12/38
JGI ISS
PTHR14155:SF2 Panther
RING-FINGER PROTEIN
JGI ISS
PF00097 PFAM
Zinc finger, C3HC4 type (RING finger)
JGI ISS
UniRef100_B9RUA7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein, putative n=1 Tax=Ricinus communis RepID=B9RUA7_RICCO
SoyBase E_val: 9.00E-46 ISS
UniRef100_I1M024 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M024_SOYBN
SoyBase E_val: 2.00E-130 ISS
Expression Patterns of Glyma13g23930
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma13g23930
Paralog Evidence Comments
Glyma19g01341 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g23930 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g170300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g23930
Coding sequences of Glyma13g23930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g23930.1 sequence type=CDS gene model=Glyma13g23930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACAGTTATTTTAACAGTGGTGTTATTATTTGTTGGATTTGTGTTCCTGGTCCTACTTCATGTTTGTTTTTCCGAGAGACTCTTTAGGAGAGGATCAATGGTTGAGAGGGGTGCAAATGTAGGCAGAAGCATGTCCATAGATGACTTGGAGATGCTTCCATGTTATGATTATGTTGCCAAAGGCAACACAAGCAGCCCTGTGGATTGTGCAGTTTGCTTGGAGAACCTCATCACAGGAGATAAGTGCAGATTGTTACCTATGTGCAAGCACAGTTTTCATGCCCAATGTGTGGACACATGGCTTCTAAAGACACCCATATGTCCAATTTGCAGGTGTAATGCTCATTCTCATAGTGGAAACCAAGTTGTAGGTAACAATGACTACTTTGTTGCACCAAATAGTGGGTCTAGGGAGAGCCAAAGTCAGCAACATGACAATATGGTATTGGTGCAGTTGAGAGAAAGCCTAGAAAATGTTCCATCCACAAATGTTGACATAGAAAATCCAACATTAGGAAGTCACAACTTGGTCAGAGAGCACTAA
Predicted protein sequences of Glyma13g23930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g23930.1 sequence type=predicted peptide gene model=Glyma13g23930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTVILTVVLLFVGFVFLVLLHVCFSERLFRRGSMVERGANVGRSMSIDDLEMLPCYDYVAKGNTSSPVDCAVCLENLITGDKCRLLPMCKHSFHAQCVDTWLLKTPICPICRCNAHSHSGNQVVGNNDYFVAPNSGSRESQSQQHDNMVLVQLRESLENVPSTNVDIENPTLGSHNLVREH*