SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g23850

Feature Type:gene_model
Chromosome:Gm13
Start:27156006
stop:27164469
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g23850
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01480AT Annotation by Michelle Graham. TAIR10: cyclophilin 38 | chr3:188569-190674 FORWARD LENGTH=437 SoyBaseE_val: 0ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010103GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042549GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II stabilization SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0003755GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity SoyBaseN/AISS
KOG0881 KOG Cyclophilin type peptidyl-prolyl cis-trans isomerase JGI ISS
PTHR11071Panther CYCLOPHILIN JGI ISS
PTHR11071:SF75Panther PEPTIDYL-PROLYL CIS-TRANS ISOMERASE JGI ISS
PF00160PFAM Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD JGI ISS
UniRef100_I1M017UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M017_SOYBN SoyBaseE_val: 0ISS
UniRef100_O22636UniRef Annotation by Michelle Graham. Most informative UniRef hit: Poly(A) polymerase n=1 Tax=Pisum sativum RepID=O22636_PEA SoyBaseE_val: 0ISS

Expression Patterns of Glyma13g23850
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g23850
ParalogEvidenceComments
Glyma19g01260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g23850 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g169500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g23850
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g23850
>Glyma13g23850.1   sequence type=CDS   gene model=Glyma13g23850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCCATCATCCCCTGCCACTACTGTGCTTCCCTCAGTCCTAGATGGTTCAATTCCAACAACACACATTCTAGGCGTTTATCCTACCCACTTCGAGGACTCCGAGGTTTGAATGCTCGTTGCTCTTACCAACCACCCCATCATTCTGAATCTCCGAACAACCATAATGGGAGGTCATTTTCCTTGAAGCAGTGTGCAATATCTATTGCACTGGCGGTTGGGTTAATAACAGGAGTTCCTACATTGGAGGGTCCCACCATTGCCCAAGCAGCTAATCCTGCATTGTCTGATCTGTCTGTTTTGATTTCTGGACCTCCAATTAAGGATCCTGGGGCATTGTTGAGATATGCTCTTCCTATTGACAATAAGGCCATTAGAGAAGTGCAAAAACCACTTGAAGATATCACAGAGAGTCTCAAGATTGCTGGAGTCAAGGCACTTGACTCTGTGGAAAGAAATGTGAGGCAGGCGTCTCGAGCTCTGAAGCAAGGGAAGACTTTAATTGTATCTGGTTTAGCTGAATCAAAGAAAGAACATGGAGTTGAACTGCTTAACAAGCTGGAAGCTGGTATAGATGAGCTTGAACTGATAGTACAGGATAGGAATCGAGATGCAGTTGCACCAAAACAGAAAGAGCTTCTTCAATATGTTGGAGGTGTTGAAGAAGACATGGTTGATGGCTTCCCATTTGAAGTACCTGAGGAATACCAAAATATGCCTTTATTGAAGGGGAGAGCAGCAGTGGATATGAAGGTCAAGGTTAAAGACAATCCAAACCTGGATGAATGTGTTTTCCACATCGTTCTTGATGGTTATAATGCCCCTGTAACTGCTGGAAATTTTGTTGATTTGGTAGAAAGGCACTTCTATGATGGCATGGAAATCCAAAGAGCGGATGGGTTTGTTGTCCAAACTGGTGATCCTGAAGGACCTGCTGAGGGTTTTATTGATCCAAGTACAGAGAAAATCAGGACAATACCATTAGAAATTACGGTGAATGGAGAAAAGGCACCTGTTTATGGATCAACTTTAGAGGAGCTTGGTCTATACAAGGCTCAAACAAAGCTTCCCTTTAATGCTTTCGGTACAATGGCAATGGCAAGAGATGAATTTGAGGACAACTCTGCCTCCAGCCAGATATTTTGGCTATTGAAAGAAAGTGAGCTAACTCCCAGTAATGCCAATATATTGGATGGTCGATATGCAGTCTTTGGCTATGTAACAGAAAATGAGGATTACTTGGCAGACCTCAAAGTTGGTGATGTCATAGAATCCATTAAAGTAGTTTCTGGGCTGGATAATTTGGTAAATCCAACCTACAAAATTGCTGGCTAG
Predicted protein sequences of Glyma13g23850
>Glyma13g23850.1   sequence type=predicted peptide   gene model=Glyma13g23850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAIIPCHYCASLSPRWFNSNNTHSRRLSYPLRGLRGLNARCSYQPPHHSESPNNHNGRSFSLKQCAISIALAVGLITGVPTLEGPTIAQAANPALSDLSVLISGPPIKDPGALLRYALPIDNKAIREVQKPLEDITESLKIAGVKALDSVERNVRQASRALKQGKTLIVSGLAESKKEHGVELLNKLEAGIDELELIVQDRNRDAVAPKQKELLQYVGGVEEDMVDGFPFEVPEEYQNMPLLKGRAAVDMKVKVKDNPNLDECVFHIVLDGYNAPVTAGNFVDLVERHFYDGMEIQRADGFVVQTGDPEGPAEGFIDPSTEKIRTIPLEITVNGEKAPVYGSTLEELGLYKAQTKLPFNAFGTMAMARDEFEDNSASSQIFWLLKESELTPSNANILDGRYAVFGYVTENEDYLADLKVGDVIESIKVVSGLDNLVNPTYKIAG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo