SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g23490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g23490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g23490

Feature Type:gene_model
Chromosome:Gm13
Start:26877467
stop:26879769
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g23490
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13960AT Annotation by Michelle Graham. TAIR10: SU(VAR)3-9 homolog 4 | chr5:4501688-4505979 FORWARD LENGTH=624 SoyBaseE_val: 0ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006270GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication initiation SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0006346GO-bp Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing SoyBaseN/AISS
GO:0007267GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell signaling SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010073GO-bp Annotation by Michelle Graham. GO Biological Process: meristem maintenance SoyBaseN/AISS
GO:0010216GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of DNA methylation SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016571GO-bp Annotation by Michelle Graham. GO Biological Process: histone methylation SoyBaseN/AISS
GO:0016572GO-bp Annotation by Michelle Graham. GO Biological Process: histone phosphorylation SoyBaseN/AISS
GO:0016579GO-bp Annotation by Michelle Graham. GO Biological Process: protein deubiquitination SoyBaseN/AISS
GO:0018022GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-lysine methylation SoyBaseN/AISS
GO:0031047GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA SoyBaseN/AISS
GO:0031048GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA SoyBaseN/AISS
GO:0034968GO-bp Annotation by Michelle Graham. GO Biological Process: histone lysine methylation SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0008327GO-mf Annotation by Michelle Graham. GO Molecular Function: methyl-CpG binding SoyBaseN/AISS
GO:0010385GO-mf Annotation by Michelle Graham. GO Molecular Function: double-stranded methylated DNA binding SoyBaseN/AISS
GO:0010428GO-mf Annotation by Michelle Graham. GO Molecular Function: methyl-CpNpG binding SoyBaseN/AISS
GO:0010429GO-mf Annotation by Michelle Graham. GO Molecular Function: methyl-CpNpN binding SoyBaseN/AISS
GO:0018024GO-mf Annotation by Michelle Graham. GO Molecular Function: histone-lysine N-methyltransferase activity SoyBaseN/AISS
GO:0042393GO-mf Annotation by Michelle Graham. GO Molecular Function: histone binding SoyBaseN/AISS
GO:0046974GO-mf Annotation by Michelle Graham. GO Molecular Function: histone methyltransferase activity (H3-K9 specific) SoyBaseN/AISS
KOG1082 KOG Histone H3 (Lys9) methyltransferase SUV39H1/Clr4, required for transcriptional silencing JGI ISS
PTHR22884Panther SET DOMAIN PROTEINS JGI ISS
PTHR22884:SF114Panther SUBFAMILY NOT NAMED JGI ISS
PF00856PFAM SET domain JGI ISS
PF02182PFAM YDG/SRA domain JGI ISS
PF05033PFAM Pre-SET motif JGI ISS
UniRef100_B9GNG0UniRef Annotation by Michelle Graham. Most informative UniRef hit: SET domain protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9GNG0_POPTR SoyBaseE_val: 0ISS
UniRef100_UPI000233D33BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D33B related cluster n=1 Tax=unknown RepID=UPI000233D33B SoyBaseE_val: 0ISS

Expression Patterns of Glyma13g23490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g23490 not represented in the dataset
Glyma13g23490 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g23490 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g166000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g23490
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g23490
>Glyma13g23490.1   sequence type=CDS   gene model=Glyma13g23490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTCAAACCAGGGCGGAGAATAGTTCGGAATCCAAAATCGCCGTGGCCAATGGCGGAAAAGTAACCAAGGCTAAGAAGAAATCGAAGTGTTCGACAATGCCGCGGAGATCGAGTGCTCGAATTCAAGCGTTGCAAAAAGCCGAGAAGGAGCTCCTTGCTCGTCAAAAAGCGGAGGTAGTAGTAGTTGAAGAGAAAGACAACTGCGAGAACGCGGTGAGGGCGAAGAAGCGCAATAGAAATAGTGGCGGTGAGGAGAGCGTAGCAGTGGAAGAAGAGGTTGTTTCGAAAAAGCGCAAGGGTAAGGTGGAAGAAGTGAATGGGAAGCAGGAAAATGCGGGTGGGGGTTTGGGGGAGAAGAGTGACCCTCTCAAGGTGAAAGAGACTGTAAGACTGTTTAACAAGTATTACCTTCATTTTGTTCAGGAAGAAGAAAAGAGGTGTGCAGCGGCTGAGCCCAAAGCTGCTAAACAAAAGGGTTCTAGAAAGGCAAAGAAGAGAGATCTAAAGGCCATGGGGAAGATGGTGGATAATAATGAAGTATTGTACCCTGGGAAAAGAATTGGCGACATTCCAGGTATTGAGGTTGGATATCAGTTCTATTCTCGTTGTGAAATGGTTGCGGTTGGTTTTCATAGCCACTGGTTAAAGGGCATTGATTATATGCCCAAATCCTATGCCAATGTGTACACTACGTATGAATTTCCAGTTGCTGTTGCCATTATTTTGTCGGGTATGTACGAGGATGATCTCGACAATGCTGACGATGTTGTATACACTGGTCAAGGTGGGCATAATCTCACTGGCAATAAGCGCCAAATCAGGGATCAGAAGTTGGAGTATGGTAACCTGGCTCTCAAGAATTGCGTTGAGCAATGTGTGCCTATTAGAGTCATTCGTGGTCATAAATCTTCAAGCAGTTACTCTGGTAAAATATACACATATGATGGCTTGTACAATGTTGTTGAATATTGGGCAGAGAAGGGAATATCTGGATTCACAGTCTACAAGTTTAGACTTAGCAGGGTTAAAGGGCAACCTAAATTAACCACAAATCAGGTATATTTTGTAAATGGACGTGTACCTCGATCTCTAACAGAGATACAAGGATTGGTCTGTGAGGACATCACTGGAGGTCAAGAAGATATTCCCATTCCGGCTACAAATTTGGTTGATGACCCTCCTGTTCCACCCACAGGTTTCACATATTGTAAGTCTCTTAAGCTTGCAAAGAATGTGAAGCTTCCAAGGATGAATGGCACCGGATGTAAATGCAAAGGCATTTGTAATGACCCAACAACCTGTGCATGTGCACTGCGTAATGGCTCTGATTTTCCATATGTATCTCGGGATGGTGGCAGGTTAGTTGAAGCCAAAGATGTTGTCTTTGAATGTGGTCCCAAATGTGGTTGTGATCCAGGTTGTGTGAACCGAACTTCTCAAAAAGGACTTAGATATCGTCTCGAGGTTTTCCGCACTGCAAACAAAGGATGGGCTGTTAGATCCTGGGATTTTATACCTTCTGGAGCACCAGTTTGTGAGTACACTGGAATACTTTCTAGGACAGATGATATGGATAGGGTATTGGAAAATAATTATATTTTCGAGATAGATTGCTTGCTAACCATGAAGGGGCTTGGGGGAAGAGAGAAACGGTCTCCAAAAGGAGAGATTTCTGCAAATCTCTTGGACAAATATGATGATCAAAGTTCTGAAAGTGCGCCAGAGTTTTGTATTGATGCAGGATCTACTGGAAATGTTGCTAGGTTTATAAACCATTGTTGTGAGCCCAATCTGTTTGTTCAATGTGTTTTGAGCACACACCATGATTTGAGATTGGCTCGTGTAATGCTGTTTGCTGCGGACAACATACCCCCTTTGCAGGAATTAACGTATGACTATGGTTATGAGCTTGATAGCGTCTTGGATTCTGATGGGAAGATCAAGCAAATGCCATGCTATTGTGGAGCCTCATACTGCAGGAAGCGATTATTCTAA
Predicted protein sequences of Glyma13g23490
>Glyma13g23490.1   sequence type=predicted peptide   gene model=Glyma13g23490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVQTRAENSSESKIAVANGGKVTKAKKKSKCSTMPRRSSARIQALQKAEKELLARQKAEVVVVEEKDNCENAVRAKKRNRNSGGEESVAVEEEVVSKKRKGKVEEVNGKQENAGGGLGEKSDPLKVKETVRLFNKYYLHFVQEEEKRCAAAEPKAAKQKGSRKAKKRDLKAMGKMVDNNEVLYPGKRIGDIPGIEVGYQFYSRCEMVAVGFHSHWLKGIDYMPKSYANVYTTYEFPVAVAIILSGMYEDDLDNADDVVYTGQGGHNLTGNKRQIRDQKLEYGNLALKNCVEQCVPIRVIRGHKSSSSYSGKIYTYDGLYNVVEYWAEKGISGFTVYKFRLSRVKGQPKLTTNQVYFVNGRVPRSLTEIQGLVCEDITGGQEDIPIPATNLVDDPPVPPTGFTYCKSLKLAKNVKLPRMNGTGCKCKGICNDPTTCACALRNGSDFPYVSRDGGRLVEAKDVVFECGPKCGCDPGCVNRTSQKGLRYRLEVFRTANKGWAVRSWDFIPSGAPVCEYTGILSRTDDMDRVLENNYIFEIDCLLTMKGLGGREKRSPKGEISANLLDKYDDQSSESAPEFCIDAGSTGNVARFINHCCEPNLFVQCVLSTHHDLRLARVMLFAADNIPPLQELTYDYGYELDSVLDSDGKIKQMPCYCGASYCRKRLF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo