SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma13g23140

Feature Type:gene_model
Chromosome:Gm13
Start:26588769
stop:26591774
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G60430AT Annotation by Michelle Graham. TAIR10: actin-related protein C3 | chr1:22264797-22265682 REVERSE LENGTH=174 SoyBaseE_val: 6.00E-115ISS
GO:0007015GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament organization SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0030833GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of actin filament polymerization SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005856GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoskeleton SoyBaseN/AISS
GO:0005885GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Arp2/3 protein complex SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG3155 KOG Actin-related protein Arp2/3 complex, subunit ARPC3 JGI ISS
PTHR12391Panther ARP2/3 COMPLEX 21 KD SUBUNIT-RELATED JGI ISS
PF04062PFAM ARP2/3 complex ARPC3 (21 kDa) subunit JGI ISS
UniRef100_I1LZT5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZT5_SOYBN SoyBaseE_val: 5.00E-125ISS
UniRef100_Q8LFW2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Contains similarity to 21 KD subunit of the Arp2/3 protein complex (ARC21) n=1 Tax=Arabidopsis thaliana RepID=Q8LFW2_ARATH SoyBaseE_val: 1.00E-111ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g11730 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g162500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g23140.1   sequence type=CDS   gene model=Glyma13g23140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTATCATTCTAGTTTTGTGAATGAAGATGGAGTGAGTAGAGCTTGTGGGTGCTCTCTTCTTCCTCTCAAGAGCCACATTAAGGGACCTGCTCCTGTTTCAGATCAAGACAGAACTGATATTGTGGATGAAGCCATAACCTTCTTCCGAGCCAATGTGTTCTTCAGAAACTTTGACATCAAGAGCCCTGCTGATAAGCTTCTCATATACCTGACCTTTTACATTAATGTTGCTCTCAAGAGGCTTGAAGGTTGCAGAACCTTGGCTGAAGGAACCAAGGCAATCATCAACTTGGGTCTCGAAAAGGTTCCTGTCCCTGGAGAGTCTGGCTTTCCATTTCCGGGCCTTTTCCCCCTTCCTCAATCACATAAGGAAGCAGAATTATTCAGAAATTATTTGAAGCAGATAAGGGAAGAAACAAGTGGGAGGTTATTGAGCGTTGCATACAGACCTAATGGCACTCCAAATAAATGGTGGTTGGCATTTGCAAAGAGGAAATTTATGAATATAATCATCCCTTGA

>Glyma13g23140.1   sequence type=predicted peptide   gene model=Glyma13g23140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVYHSSFVNEDGVSRACGCSLLPLKSHIKGPAPVSDQDRTDIVDEAITFFRANVFFRNFDIKSPADKLLIYLTFYINVALKRLEGCRTLAEGTKAIINLGLEKVPVPGESGFPFPGLFPLPQSHKEAELFRNYLKQIREETSGRLLSVAYRPNGTPNKWWLAFAKRKFMNIIIP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo