Glyma13g22950 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g22950

Feature Type:	gene_model
Chromosome:	Gm13
Start:	26423501
stop:	26428290
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g22950

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G11150	AT	Annotation by Michelle Graham. TAIR10: vesicle-associated membrane protein 713 \| chr5:3546625-3547844 REVERSE LENGTH=221	SoyBase	E_val: 6.00E-113	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG0859	KOG	Synaptobrevin/VAMP-like protein	JGI		ISS
PTHR21136	Panther	SNARE PROTEINS	JGI		ISS
PTHR21136:SF77	Panther		JGI		ISS
PF00957	PFAM	Synaptobrevin	JGI		ISS
UniRef100_G7JFD0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vesicle-associated membrane protein n=1 Tax=Medicago truncatula RepID=G7JFD0_MEDTR	SoyBase	E_val: 1.00E-142	ISS
UniRef100_I1LZR3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZR3_SOYBN	SoyBase	E_val: 6.00E-165	ISS

Expression Patterns of Glyma13g22950

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g22950

Paralog	Evidence	Comments
Glyma17g11930	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g22950 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g160500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g22950

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g22950

Limit To All Plant Sequences

>Glyma13g22950.1   sequence type=CDS   gene model=Glyma13g22950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGATATTGTATGGAATGGTGGCAAGGGGGCAGGTGGTTCTGGCTGAGTTCAGCGCCACCCAGAGTAATGCTAGTGTAGTAGCCAAACAGATACTCAGCAAGATCAATCAAGGGAGTGATAACAATAATGATTCCAATGTTTCCTTTTCCCACGATCGCTATGTTTTTCATGTCAAGAGGACAGATGGCCTCACTGTTCTTTGCATGGCTGATGATGCATTTGGAAGAATAGCCCCTTTTGCATTTCTTGAAGATATTCATAAAAAATTTGTGAAGACGTATGCCCGTGCTATTCTTTCAGCTCCTGCCTATGCCATGAATGATGAGTTCTCAAGGGTCTTGAACCAACAGATGGAATATTACTCCAATGACCCAAATGCTGACAGATTAAACCGTCTCAAAGGTGAAATGACTCAGGTGAGAACGGTGATGATAGACAACATTGACAAAGTGTTGGAGAGAGGTGGTCGGTTGGAGCTGCTGGTGGAGAAAACTTCAGCAATGAATAGCAATTCGATTCGTTTCAAAAGGCAGTCCCGCCGTTATAAAAATAACCTGTGGTGGAGTAATGTTAGGCTAACGGTTGCACTTGTTATAATTTTCGTCATTGTCGTTTACATTATACTCGCCTTCATCTGCCATGGTCCCTTGTTGTCTTCGTGCTGGAGATAA

Predicted protein sequences of Glyma13g22950

Limit To All Plant Sequences

>Glyma13g22950.1   sequence type=predicted peptide   gene model=Glyma13g22950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGILYGMVARGQVVLAEFSATQSNASVVAKQILSKINQGSDNNNDSNVSFSHDRYVFHVKRTDGLTVLCMADDAFGRIAPFAFLEDIHKKFVKTYARAILSAPAYAMNDEFSRVLNQQMEYYSNDPNADRLNRLKGEMTQVRTVMIDNIDKVLERGGRLELLVEKTSAMNSNSIRFKRQSRRYKNNLWWSNVRLTVALVIIFVIVVYIILAFICHGPLLSSCWR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain