Report for Sequence Feature Glyma13g22631
Feature Type: gene_model
Chromosome: Gm13
Start: 26122581
stop: 26125822
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g22631
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G02530 AT
Annotation by Michelle Graham. TAIR10: chloroplast thylakoid lumen protein | chr4:1112335-1114005 REVERSE LENGTH=216
SoyBase E_val: 5.00E-38 ISS
GO:0006098 GO-bp
Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt
SoyBase N/A ISS
GO:0006364 GO-bp
Annotation by Michelle Graham. GO Biological Process: rRNA processing
SoyBase N/A ISS
GO:0006636 GO-bp
Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process
SoyBase N/A ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009409 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cold
SoyBase N/A ISS
GO:0009697 GO-bp
Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process
SoyBase N/A ISS
GO:0009814 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction
SoyBase N/A ISS
GO:0010027 GO-bp
Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization
SoyBase N/A ISS
GO:0015979 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis
SoyBase N/A ISS
GO:0015995 GO-bp
Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process
SoyBase N/A ISS
GO:0016117 GO-bp
Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process
SoyBase N/A ISS
GO:0019288 GO-bp
Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway
SoyBase N/A ISS
GO:0019684 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0043085 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009534 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid
SoyBase N/A ISS
GO:0009535 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane
SoyBase N/A ISS
GO:0009543 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen
SoyBase N/A ISS
GO:0009570 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma
SoyBase N/A ISS
GO:0009579 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: thylakoid
SoyBase N/A ISS
GO:0009941 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope
SoyBase N/A ISS
GO:0031977 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_G7JE46 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Thylakoid lumenal 16.5 kDa protein n=1 Tax=Medicago truncatula RepID=G7JE46_MEDTR
SoyBase E_val: 5.00E-51 ISS
UniRef100_UPI000233D1D8 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233D1D8 related cluster n=1 Tax=unknown RepID=UPI000233D1D8
SoyBase E_val: 2.00E-87 ISS
Expression Patterns of Glyma13g22631
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma13g22631
Paralog Evidence Comments
Glyma17g12190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g22631 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g157900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g22631
Coding sequences of Glyma13g22631
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g22631.1 sequence type=CDS gene model=Glyma13g22631 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACCAACAGCAACGCAAACATATGTTTACCACACCATCAAGTTCAGTGTGAAAGGCAATTAACTCTTTGCCAAGCAGTTAATCGGCTAGCAACACACACTCCAATTTTGACCAAAAGAGGCTTATCCATCAGTTTTCTCACCGCATTTTTGGTTTCATTGGCTGGTGAGGATGCTAATGCTGCAATACTTGAAGCAGATGATGACGAGGAGCGGTTGGAAAAAGTAAAGAGGGATAGAAAAAAGAGACTTGAGAGACAAGGTGTGATCAAATCATCCACCAAAGAAACAGGGTATCTTCAGGATTTGGTGTATAAACTAAGTAAAGTTGGTAAAGCAATTGAAAACAGTGATCTATCTACAGCTGCTTCTGTGTTTGGGAGTGGCACTGATACTGATTGGGTGCAAAATGCTAATATATCTTTGAATAAGTTTCTGGGTAACCTTTTAACATTTGAGTGCCAGTGCTGA
Predicted protein sequences of Glyma13g22631
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g22631.1 sequence type=predicted peptide gene model=Glyma13g22631 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTNSNANICLPHHQVQCERQLTLCQAVNRLATHTPILTKRGLSISFLTAFLVSLAGEDANAAILEADDDEERLEKVKRDRKKRLERQGVIKSSTKETGYLQDLVYKLSKVGKAIENSDLSTAASVFGSGTDTDWVQNANISLNKFLGNLLTFECQC*