SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g22300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g22300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g22300

Feature Type:gene_model
Chromosome:Gm13
Start:25856536
stop:25858450
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G58070AT Annotation by Michelle Graham. TAIR10: temperature-induced lipocalin | chr5:23500512-23501156 REVERSE LENGTH=186 SoyBaseE_val: 3.00E-103ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
KOG4824 KOG Apolipoprotein D/Lipocalin JGI ISS
PTHR10612Panther LIPOCALIN/APOLIPOPROTEIN D JGI ISS
PTHR10612:SF7Panther OUTER MEMBRANE LIPOPROTEIN BLC JGI ISS
PF08212PFAM Lipocalin-like domain JGI ISS
UniRef100_C6SY43UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SY43_SOYBN SoyBaseE_val: 4.00E-134ISS
UniRef100_Q38JC8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Outer membrane lipoprotein blc n=1 Tax=Medicago truncatula RepID=Q38JC8_MEDTR SoyBaseE_val: 8.00E-111ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g22300 not represented in the dataset

Glyma13g22300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g08360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g155200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g22300.1   sequence type=CDS   gene model=Glyma13g22300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGACCAAAGCGATGGAGGTGGTGAAGGATCTGGACGTGAAGCGGTACATGGGTCGGTGGTACGAGATTGCGTGCTTCCCGTCGAGGTTTCAACCCAGTGACGGCACCAACACCAGAGCCACCTACACTCTCCGAGATGACGGCACCATCAACGTTCTTAACGAGACTTGGAGTGGCGGCAAAAGAGGTTTCATTGAGGGCACTGCTTATAAGGCTGATCCCAACAGCGACGAGGCCAAGTTGAAGGTCAAGTTCTGGGTGCCTCCCTTTTTACCCATCATTCCCGTTACTGGGGATTACTGGCTTTTGTACATTGACCAGGATTATCACTATGCTGTCATTGGCCAACCTTCCAGGAATTATCTTTGGATATTGTCCAGGAAGAACCATATGGATGAGGAAACCTACAACCAGCTTGTTGAGAGAGCTAAGGATGAGGGGTATGATGTGAGCAAACTCCACAAGACTCCACACAGTGATTCTCCACCGGAGGAAGAAGGTCCTCAGGACACCAAAGGCGTTTGGTGGATCAAGTCCCTTCTGGGGAAATAG

>Glyma13g22300.1   sequence type=predicted peptide   gene model=Glyma13g22300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTKAMEVVKDLDVKRYMGRWYEIACFPSRFQPSDGTNTRATYTLRDDGTINVLNETWSGGKRGFIEGTAYKADPNSDEAKLKVKFWVPPFLPIIPVTGDYWLLYIDQDYHYAVIGQPSRNYLWILSRKNHMDEETYNQLVERAKDEGYDVSKLHKTPHSDSPPEEEGPQDTKGVWWIKSLLGK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo