SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g22250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g22250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g22250

Feature Type:gene_model
Chromosome:Gm13
Start:25839224
stop:25844103
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g22250
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G63270AT Annotation by Michelle Graham. TAIR10: non-intrinsic ABC protein 10 | chr1:23469664-23470353 REVERSE LENGTH=229 SoyBaseE_val: 9.00E-143ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0017004GO-bp Annotation by Michelle Graham. GO Biological Process: cytochrome complex assembly SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
PTHR24220Panther FAMILY NOT NAMED JGI ISS
PTHR24220:SF167Panther SUBFAMILY NOT NAMED JGI ISS
PF00005PFAM ABC transporter JGI ISS
UniRef100_D7KTJ5UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATNAP10 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KTJ5_ARALL SoyBaseE_val: 6.00E-141ISS
UniRef100_I1LZL4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZL4_SOYBN SoyBaseE_val: 9.00E-164ISS

Expression Patterns of Glyma13g22250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g22250 not represented in the dataset
Glyma13g22250 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g22250 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g154800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g22250
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g22250
>Glyma13g22250.1   sequence type=CDS   gene model=Glyma13g22250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAGAAGACCCCCACTCCCTCGTCTCCTCCTTAACAATGTCTCTTGCATGAGAAATGCCCAGCAAGTTCTGCGCCATGTGAATGTCTCTCTTCATGATGGAGGGGCACTTGTGCTAACAGGTGCAAATGGCTCGGGAAAGACAACTTTCCTGCGCATGTTAGCTGGGTTTTCCCGCCCTTCTGCTGGTGAAATCCTTTGGAATGGACATGACATTCAACAATCTACAATATTCCATCAGTATAAACTTCAGCTTAACTGGCTCTCTCTCAAGGATGCCATTGATAATAAGATGTCAGTTCTTAACAATGTACAATGGTTTGAACTTCTTGAAAACAAGGAAGGGAAGGCTATGGCTGCACTAGAGTTGATGGGACTAGGAAGATTAGCCAACGAAAAACCAAGGATGCTATCTATGGGCCAGCGGAAAAGACTGCAACTTGCCAGATTGCTGGCACTTGATCGCCCCATATGGTTGCTAGATGAGCCTTCAGTTGCACTAGATGATGACGGTGTGAAGTTACTTGAGTATATTATTGCAGAACACAGGAAATATGGAGGAATTGTGATTGTGGCAACTCATCTACCCATTGAGATAGAAGATTCCTTAGTCTTGAGGCTTCCACCAAGGTTTCCAAGGAGGATGACCCTTGTGGATATGCTTGACCGGGCAGATATCAGTTAA
Predicted protein sequences of Glyma13g22250
>Glyma13g22250.1   sequence type=predicted peptide   gene model=Glyma13g22250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRRPPLPRLLLNNVSCMRNAQQVLRHVNVSLHDGGALVLTGANGSGKTTFLRMLAGFSRPSAGEILWNGHDIQQSTIFHQYKLQLNWLSLKDAIDNKMSVLNNVQWFELLENKEGKAMAALELMGLGRLANEKPRMLSMGQRKRLQLARLLALDRPIWLLDEPSVALDDDGVKLLEYIIAEHRKYGGIVIVATHLPIEIEDSLVLRLPPRFPRRMTLVDMLDRADIS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo