SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g22160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g22160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g22160

Feature Type:gene_model
Chromosome:Gm13
Start:25732123
stop:25739079
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03880AT Annotation by Michelle Graham. TAIR10: Thioredoxin family protein | chr5:1038674-1041453 REVERSE LENGTH=339 SoyBaseE_val: 3.00E-134ISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
UniRef100_Q9LZC1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Emb|CAB85508.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LZC1_ARATH SoyBaseE_val: 1.00E-121ISS
UniRef100_UPI000233D075UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D075 related cluster n=1 Tax=unknown RepID=UPI000233D075 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g22160 not represented in the dataset

Glyma13g22160 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g154000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g22160.2   sequence type=CDS   gene model=Glyma13g22160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTTTGAACACGTTGTCACACGAGCTTAGAGTGGACAAAATCCTAATATACTTCCAAACAACCGCGCTAAGGTTGGAACTTGGAGGAACTTGTGTCTGTGTCCCTTTTTACAGAGTCATGACTATGGCTGGAGCTTTGAGTCTCTCCCAATTCCCAGTTCGTGGGTCTGTTTCTTTGCCCAAAAGAAGAATACCCAGAAGAAGCTTTTGCATTAGGGGCATGTCAGAAATCTCTTCCACTTTTTCTGTGAGCACCCAACAAGAAGAACCAACTTCTAATGCTTCGTCAGTGACAATTGCACCTCCCCCCAACTTCAAGCCCCCTGAGCCTAAACGCTTTGCAATCAGACCTGACAAGACCAGTGAAGTATTTGGAGCTTTGCTTCCTTTGCTCTTTCGCTTTGCTACCGGAGTTTTCGTTTCTGGGTATTCTTTTTCAATTGTTTCTAAGGATGAAATTCCTCCAGATGAATATGCTTTGGAACTTAATGGCGTTACCATAAAAGAAACAGCAAAATTAGGCCCTCGCCCAGAGAAGCCTATTGAGATATATGAATTTGAGACCTGTCCATTTTGCCGAAAGGTTAGAGAAATTGTTGCCATTTTGGACCTTGATGTTCTTTTCTATCCTTGTCCAAGAAATGGCCCAAATTTCCGTCAAAAGGTTCTAGAGATGGGTGGCAAACTGCAGTTCCCCTACATGGTTGACCCAAACACAGGCGCTTCAATGTATGAATCAGATGACATAATTCGGTATTTGGTTGACAAATATGGTGATGGAAACGTTCCTCTATCTTTATCACTTGGATTTTTAACGACCCTAACTGCTGGTCTTGGTATGCTTAGTCGTATTTCAAAGGGGACTACTTATACTCCAGCGAAGTTCCCTCCAAAGCCACTTAAATTATGGGCATATGGGGGGTCTCCTTTCTGCAAACTTGTACGTGAAGTACTTGTGGAATTGGAGCTGCCACACTTGCTTGTCTGTTGTGCTAGGGGTAGCCCAAAGAGAAATATACTATATCAGAAAACTGGAACTTTCCAGGTATTTGATTTTTCTAGTGAGTTTGTCAGGTTGATGCAATACACAGTTGTTTCGTGA

>Glyma13g22160.2   sequence type=predicted peptide   gene model=Glyma13g22160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTLNTLSHELRVDKILIYFQTTALRLELGGTCVCVPFYRVMTMAGALSLSQFPVRGSVSLPKRRIPRRSFCIRGMSEISSTFSVSTQQEEPTSNASSVTIAPPPNFKPPEPKRFAIRPDKTSEVFGALLPLLFRFATGVFVSGYSFSIVSKDEIPPDEYALELNGVTIKETAKLGPRPEKPIEIYEFETCPFCRKVREIVAILDLDVLFYPCPRNGPNFRQKVLEMGGKLQFPYMVDPNTGASMYESDDIIRYLVDKYGDGNVPLSLSLGFLTTLTAGLGMLSRISKGTTYTPAKFPPKPLKLWAYGGSPFCKLVREVLVELELPHLLVCCARGSPKRNILYQKTGTFQVFDFSSEFVRLMQYTVVS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo