Glyma13g22086 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g22086): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g22086): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g22086

Feature Type:	gene_model
Chromosome:	Gm13
Start:	25676934
stop:	25679633
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g22086

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G52730	AT	Annotation by Michelle Graham. TAIR10: ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein \| chr3:19543146-19544167 REVERSE LENGTH=72	SoyBase	E_val: 1.00E-32	ISS
GO:0006122	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitochondrial electron transport, ubiquinol to cytochrome c	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005740	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial envelope	SoyBase	N/A	ISS
GO:0005750	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex III	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008121	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquinol-cytochrome-c reductase activity	SoyBase	N/A	ISS
KOG3494	KOG	Ubiquinol cytochrome c oxidoreductase, subunit QCR9	JGI		ISS
PTHR12980	Panther	UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX, SUBUNIT X	JGI		ISS
PF05365	PFAM	Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like	JGI		ISS
UniRef100_G7L638	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ubiquinol-cytochrome c reductase complex protein n=1 Tax=Medicago truncatula RepID=G7L638_MEDTR	SoyBase	E_val: 2.00E-33	ISS
UniRef100_I1LZK1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZK1_SOYBN	SoyBase	E_val: 7.00E-46	ISS

Expression Patterns of Glyma13g22086

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g22086 not represented in the dataset	Glyma13g22086 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g22086 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g153500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g22086

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g22086

Limit To All Plant Sequences

>Glyma13g22086.1   sequence type=CDS   gene model=Glyma13g22086   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCAGTGCCTCGAAGAAGCAGAGGAGGAGGCGTTTTCGAAAGCCTCTACAAGGTCCTCATGCGCCGCAACTCCGTCTACGTCACCTTCATCATCGCCGGCGCCTTCCTCGGAGAGCGGGCTGTGGATTACGGAGTTCACAAGATCTGGGAGCACAATAACGTTGGGAAACGATATGAAGACATTCCTGTACTAGGGCAAAGGCAATCAGAAGAGTGA

Predicted protein sequences of Glyma13g22086

Limit To All Plant Sequences

>Glyma13g22086.1   sequence type=predicted peptide   gene model=Glyma13g22086   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSVPRRSRGGGVFESLYKVLMRRNSVYVTFIIAGAFLGERAVDYGVHKIWEHNNVGKRYEDIPVLGQRQSEE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain