Report for Sequence Feature Glyma13g22030
Feature Type: gene_model
Chromosome: Gm13
Start: 25591798
stop: 25594878
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g22030
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G27550 AT
Annotation by Michelle Graham. TAIR10: centroradialis | chr2:11773417-11774509 FORWARD LENGTH=175
SoyBase E_val: 1.00E-91 ISS
GO:0000041 GO-bp
Annotation by Michelle Graham. GO Biological Process: transition metal ion transport
SoyBase N/A ISS
GO:0009910 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development
SoyBase N/A ISS
GO:0010228 GO-bp
Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0008429 GO-mf
Annotation by Michelle Graham. GO Molecular Function: phosphatidylethanolamine binding
SoyBase N/A ISS
KOG3346
KOG
Phosphatidylethanolamine binding protein
JGI ISS
PTHR11362 Panther
PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN
JGI ISS
PF01161 PFAM
Phosphatidylethanolamine-binding protein
JGI ISS
UniRef100_G7Z0B4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: CENTRORADIALIS-like protein 1 n=1 Tax=Glycine max RepID=G7Z0B4_SOYBN
SoyBase E_val: 1.00E-125 ISS
UniRef100_G7Z0B4 UniRef
Annotation by Michelle Graham. Best UniRef hit: CENTRORADIALIS-like protein 1 n=1 Tax=Glycine max RepID=G7Z0B4_SOYBN
SoyBase E_val: 1.00E-125 ISS
Expression Patterns of Glyma13g22030
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma13g22030
Paralog Evidence Comments
Glyma10g08340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g22030 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.11g209500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g22030
Coding sequences of Glyma13g22030
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g22030.1 sequence type=CDS gene model=Glyma13g22030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAAAGATGTGGACAGATCCTCTATTTATTGGGAGAGTTATAGGAGATGTTCTTGACTCTTTCACCCCAACCATAAAAATGACCGTAACTTACAAGAAGCAAGTCTACAATGGGCACGAGTTCTTCCCTTCCACAATTACCACAAGGCCGAAGGTTGAGATTGGTGGAGGAGATATGAGGTCATTCTATACACTGATTATGACTGACCCGGATGTCCCTGGTCCTAGTGATCCTTACCTGAGAGAGCATTTGCACTGGATGGTGACAGACATTCCAGGCACAACAAATGCCTCATTTGGGAATGTGTTGGTGAGCTATGAGATGCCAAAGCCTAACATAGGGATACACAGGTATGTGTTTGTCCTGTTTAAGCAAAAACGTAGGCAGTGTGTAACTCGTCCACCTTCTTCAAGGGATCACTTCAGCACTCGCAAATTCTCAGCTGAGAATGACCTTGGCCTCCCTGTCGCTTCTGTCTACTTCAATGCACAGAGAGAAACTGCTGCAAGAAGACGCTAG
Predicted protein sequences of Glyma13g22030
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g22030.1 sequence type=predicted peptide gene model=Glyma13g22030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAKMWTDPLFIGRVIGDVLDSFTPTIKMTVTYKKQVYNGHEFFPSTITTRPKVEIGGGDMRSFYTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTNASFGNVLVSYEMPKPNIGIHRYVFVLFKQKRRQCVTRPPSSRDHFSTRKFSAENDLGLPVASVYFNAQRETAARRR*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
