Warning : Undefined variable $sxsome in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $sstart in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $send in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g21895): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1019
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g21895): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1021
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1025
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1031
Report for Sequence Feature Glyma13g21895
Feature Type: gene_model
Chromosome: Gm13
Start: 25405330
stop: 25415587
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g21895
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G18950 AT
Annotation by Michelle Graham. TAIR10: homogentisate phytyltransferase 1 | chr2:8207491-8210047 FORWARD LENGTH=393
SoyBase E_val: 2.00E-120 ISS
GO:0000096 GO-bp
Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process
SoyBase N/A ISS
GO:0006546 GO-bp
Annotation by Michelle Graham. GO Biological Process: glycine catabolic process
SoyBase N/A ISS
GO:0006636 GO-bp
Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process
SoyBase N/A ISS
GO:0006733 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process
SoyBase N/A ISS
GO:0006766 GO-bp
Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process
SoyBase N/A ISS
GO:0008652 GO-bp
Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process
SoyBase N/A ISS
GO:0009072 GO-bp
Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process
SoyBase N/A ISS
GO:0009106 GO-bp
Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process
SoyBase N/A ISS
GO:0009108 GO-bp
Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process
SoyBase N/A ISS
GO:0009117 GO-bp
Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process
SoyBase N/A ISS
GO:0009266 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus
SoyBase N/A ISS
GO:0009416 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to light stimulus
SoyBase N/A ISS
GO:0009695 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process
SoyBase N/A ISS
GO:0009915 GO-bp
Annotation by Michelle Graham. GO Biological Process: phloem sucrose loading
SoyBase N/A ISS
GO:0009965 GO-bp
Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis
SoyBase N/A ISS
GO:0010189 GO-bp
Annotation by Michelle Graham. GO Biological Process: vitamin E biosynthetic process
SoyBase N/A ISS
GO:0015994 GO-bp
Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process
SoyBase N/A ISS
GO:0019216 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process
SoyBase N/A ISS
GO:0019288 GO-bp
Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway
SoyBase N/A ISS
GO:0019748 GO-bp
Annotation by Michelle Graham. GO Biological Process: secondary metabolic process
SoyBase N/A ISS
GO:0030154 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell differentiation
SoyBase N/A ISS
GO:0031347 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of defense response
SoyBase N/A ISS
GO:0031408 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process
SoyBase N/A ISS
GO:0042362 GO-bp
Annotation by Michelle Graham. GO Biological Process: fat-soluble vitamin biosynthetic process
SoyBase N/A ISS
GO:0044272 GO-bp
Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process
SoyBase N/A ISS
GO:0045893 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0071555 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell wall organization
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0016021 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane
SoyBase N/A ISS
GO:0004659 GO-mf
Annotation by Michelle Graham. GO Molecular Function: prenyltransferase activity
SoyBase N/A ISS
GO:0010176 GO-mf
Annotation by Michelle Graham. GO Molecular Function: homogentisate phytyltransferase activity
SoyBase N/A ISS
PTHR11048 Panther
PRENYLTRANSFERASES
JGI ISS
PTHR11048:SF1 Panther
4-HYDROXYBENZOATE OCTAPRENYLTRANSFERASE
JGI ISS
PF01040 PFAM
UbiA prenyltransferase family
JGI ISS
UniRef100_B9A1Q4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Glycinol 4-dimethylallyltransferase n=1 Tax=Glycine max RepID=G4DT_SOYBN
SoyBase E_val: 0 ISS
UniRef100_UPI000233D06E UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233D06E related cluster n=1 Tax=unknown RepID=UPI000233D06E
SoyBase E_val: 0 ISS
Expression Patterns of Glyma13g21895
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma13g21895
Paralog Evidence Comments
Glyma10g08095 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g21895 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.11g210500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g21895
Coding sequences of Glyma13g21895
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g21895.1 sequence type=CDS gene model=Glyma13g21895 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATTCGATGCATGTTATTATGTCTTCTCCTAATGCTCCAGTCACAACTGGTGGAAATCTCTGGAGGAGTAAACATTCCACTGAGAAAATATACCATGCAAGTTCTTGTGCATCAAAAGCTTCGCAAAACAAAAGGAAAATTCAAATGGAATACAATCTTTTGAGGTTCCAACACCCAAGTTTGAATCATCATTACAAATGTATTGAAGGAGGGTCTGCATATCAAGAATGGAATAAAAAATATGTCGTGAAAGCAACCTCTAAACCATCTTTTGATTCTGGACTTCCAACTTCTAATTCCAAAAACATGTTGGACTCTGTAAAAAATTTCTTGGCAGCTTTTTATTTGTTTTGCTACCCTTACATAATGATTGGCCGAACGTTAAGCACAATTTCTGCAAGTCTCATTGCCGTGCAGAAACTATCAGATATATCTCCATTGTTTATTATTGGTTTGTTACAGGCCTTGGTACCTTACACGTTTTTGGATGTTTATATTAATGGACTGAATCAGTTGTCTGACATTGAAATAGACAAGATAAATAAACCATATCTTCCATTGGCATCTGGACAATTGTCCTTTAGAACTGGTGTTATTATTGCTGGATCATCTTTAATTTTGAGTTTTTGGCTTGGCTGGATTATAGGTTCTTGGCCACTGATTTGGAGTCTTGTAATGTGTTTTTCACTATGGACCGCTTATTCAATCAACGTACCGTTGTTGAGATGGAAGAGACATCCTCTACTTGCAGCAATGTGCATTTTTCTTAGTTTTACAATTATATTTCCAATTACATTTTTCCTTCACATGCAGACTTTTGTGTTGAAGAGACCATTTGTCTTTCCGAGATCACTGGTTTTTGTTATTGTATTCATGAGCTTCTACACTGTAGGCATAGCGTTGTTCAAGGACATACCTGACATTGAAGGAGATAAGAAATATGGCATCCATTCTTTTTCAGCACGTTTAGGTCAAAAACGGGTATTCTGGATTTGTGTTTCACTTTTTGAAATGGCCTTTGGAGTTGCCCTCTTGGCAGGAGCAGCATCTTCTTGCCTTTGGATTAAAATTGTCACGGGTCTGGGACATGCTGCTCTTGGTTCCGTTCTTTGGTATCAGGCCAAATATGTAGATTTGACAAACAAAGTTTCCATGAGATCCTTCTATATGTTGATTTGGAAGTTGTTGTCCGTAGCATACTTCCTCATGCCTTTAATCAGATAA
Predicted protein sequences of Glyma13g21895
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g21895.1 sequence type=predicted peptide gene model=Glyma13g21895 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDSMHVIMSSPNAPVTTGGNLWRSKHSTEKIYHASSCASKASQNKRKIQMEYNLLRFQHPSLNHHYKCIEGGSAYQEWNKKYVVKATSKPSFDSGLPTSNSKNMLDSVKNFLAAFYLFCYPYIMIGRTLSTISASLIAVQKLSDISPLFIIGLLQALVPYTFLDVYINGLNQLSDIEIDKINKPYLPLASGQLSFRTGVIIAGSSLILSFWLGWIIGSWPLIWSLVMCFSLWTAYSINVPLLRWKRHPLLAAMCIFLSFTIIFPITFFLHMQTFVLKRPFVFPRSLVFVIVFMSFYTVGIALFKDIPDIEGDKKYGIHSFSARLGQKRVFWICVSLFEMAFGVALLAGAASSCLWIKIVTGLGHAALGSVLWYQAKYVDLTNKVSMRSFYMLIWKLLSVAYFLMPLIR*